Silkworm BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001308-TA|BGIBMGA001308-PA|IPR004272|Odorant binding
protein, IPR013053|Hormone binding
         (219 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF229178-1|AAF69491.1|  753|Homo sapiens leucine rich repeat and...    30   7.2  

>AF229178-1|AAF69491.1|  753|Homo sapiens leucine rich repeat and
           death domain containing protein protein.
          Length = 753

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 19  ECIQKVIEVVAPKFADGIAELGIAPLDPVQLGT 51
           E ++ V+E+   K+ D I  +G+AP DPV  G+
Sbjct: 710 EEVRAVLELGRRKYQDSIRRMGLAPKDPVLPGS 742


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.319    0.136    0.397 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,761,974
Number of Sequences: 224733
Number of extensions: 1103292
Number of successful extensions: 2037
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2036
Number of HSP's gapped (non-prelim): 1
length of query: 219
length of database: 73,234,838
effective HSP length: 87
effective length of query: 132
effective length of database: 53,683,067
effective search space: 7086164844
effective search space used: 7086164844
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 63 (29.5 bits)