BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001307-TA|BGIBMGA001307-PA|IPR001424|Superoxide dismutase, copper/zinc binding (154 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.5 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 1.5 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.6 bits (46), Expect = 1.5 Identities = 10/43 (23%), Positives = 17/43 (39%) Query: 51 DNTNGCTSAGAHFNPEKQDHGGPSSAVRHVGDLGNIEAIEDSG 93 DN C S G P + D + ++ G L + ++ G Sbjct: 655 DNLGSCGSMGDAHTPPEDDAESLNQSISSPGALSGLSSLTSPG 697 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.6 bits (46), Expect = 1.5 Identities = 10/43 (23%), Positives = 17/43 (39%) Query: 51 DNTNGCTSAGAHFNPEKQDHGGPSSAVRHVGDLGNIEAIEDSG 93 DN C S G P + D + ++ G L + ++ G Sbjct: 547 DNLGSCGSMGDAHTPPEDDAESLNQSISSPGALSGLSSLTSPG 589 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.136 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,071 Number of Sequences: 317 Number of extensions: 1585 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 154 length of database: 114,650 effective HSP length: 52 effective length of query: 102 effective length of database: 98,166 effective search space: 10012932 effective search space used: 10012932 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.0 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -