BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001305-TA|BGIBMGA001305-PA|undefined (95 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 20 6.0 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 20 6.0 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 19 7.9 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 19 7.9 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 19 7.9 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 19.8 bits (39), Expect = 6.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 12 EHPPKKSRSDLAIYAMVTAT 31 EH KKS++ LA+ A T Sbjct: 72 EHKKKKSKTILAVNAEADIT 91 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 19.8 bits (39), Expect = 6.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 12 EHPPKKSRSDLAIYAMVTAT 31 EH KKS++ LA+ A T Sbjct: 72 EHKKKKSKTILAVNAEADIT 91 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 19.4 bits (38), Expect = 7.9 Identities = 11/35 (31%), Positives = 16/35 (45%) Query: 59 VGTNSLKQLFLDDFWGSPMADVNSHKSYRPLTTLS 93 V T S+ F+ + W VN +SY + T S Sbjct: 80 VETLSVGSEFIKNIWVPDTFFVNEKQSYFHIATTS 114 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 19.4 bits (38), Expect = 7.9 Identities = 11/35 (31%), Positives = 16/35 (45%) Query: 59 VGTNSLKQLFLDDFWGSPMADVNSHKSYRPLTTLS 93 V T S+ F+ + W VN +SY + T S Sbjct: 80 VETLSVGSEFIKNIWVPDTFFVNEKQSYFHIATTS 114 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 19.4 bits (38), Expect = 7.9 Identities = 11/35 (31%), Positives = 16/35 (45%) Query: 59 VGTNSLKQLFLDDFWGSPMADVNSHKSYRPLTTLS 93 V T S+ F+ + W VN +SY + T S Sbjct: 19 VETLSVGSEFIKNIWVPDTFFVNEKQSYFHIATTS 53 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.132 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,278 Number of Sequences: 429 Number of extensions: 896 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 95 length of database: 140,377 effective HSP length: 49 effective length of query: 46 effective length of database: 119,356 effective search space: 5490376 effective search space used: 5490376 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.4 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -