Silkworm BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001304-TA|BGIBMGA001304-PA|undefined
         (114 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    22   2.1  

>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 21.8 bits (44), Expect = 2.1
 Identities = 9/38 (23%), Positives = 20/38 (52%)

Query: 41  DEILRNDQSCYLRSKYAVKFTGLCLEIIDAVQVKLGGY 78
           +E++  + +  + +KYA+KF      I+D +   +  Y
Sbjct: 867 EELVPLEGNLMINNKYALKFFPFDKHILDKLPTLISNY 904


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.134    0.406 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 35,198
Number of Sequences: 429
Number of extensions: 1313
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 114
length of database: 140,377
effective HSP length: 50
effective length of query: 64
effective length of database: 118,927
effective search space:  7611328
effective search space used:  7611328
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)
S2: 39 (19.8 bits)