BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001301-TA|BGIBMGA001301-PA|IPR002159|CD36 antigen (412 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 22 9.2 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 22 9.2 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 22 9.2 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 21.8 bits (44), Expect = 9.2 Identities = 13/53 (24%), Positives = 24/53 (45%) Query: 106 VGMINRALEQFFTNLTDPFQTVKVKDLFFDGLFLNCEGDNTALGLICGKIRAE 158 V +++ AL FT +TD Q++ + + N D L +C ++ E Sbjct: 234 VMLLSTALAYRFTQVTDRTQSMSESKNKSESAWKNLREDYNRLCRLCKRVDEE 286 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 21.8 bits (44), Expect = 9.2 Identities = 13/53 (24%), Positives = 24/53 (45%) Query: 106 VGMINRALEQFFTNLTDPFQTVKVKDLFFDGLFLNCEGDNTALGLICGKIRAE 158 V +++ AL FT +TD Q++ + + N D L +C ++ E Sbjct: 234 VMLLSTALAYRFTQVTDRTQSMSESKNKSESAWKNLREDYNRLCRLCKRVDEE 286 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 21.8 bits (44), Expect = 9.2 Identities = 13/53 (24%), Positives = 24/53 (45%) Query: 106 VGMINRALEQFFTNLTDPFQTVKVKDLFFDGLFLNCEGDNTALGLICGKIRAE 158 V +++ AL FT +TD Q++ + + N D L +C ++ E Sbjct: 234 VMLLSTALAYRFTQVTDRTQSMSESKNKSESAWKNLREDYNRLCRLCKRVDEE 286 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.138 0.422 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,641 Number of Sequences: 317 Number of extensions: 4241 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 3 length of query: 412 length of database: 114,650 effective HSP length: 58 effective length of query: 354 effective length of database: 96,264 effective search space: 34077456 effective search space used: 34077456 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -