BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001301-TA|BGIBMGA001301-PA|IPR002159|CD36 antigen (412 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48200.1 68418.m05954 hypothetical protein 33 0.46 At5g49820.1 68418.m06170 expressed protein contains Pfam domain,... 28 9.9 >At5g48200.1 68418.m05954 hypothetical protein Length = 216 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/46 (34%), Positives = 23/46 (50%) Query: 110 NRALEQFFTNLTDPFQTVKVKDLFFDGLFLNCEGDNTALGLICGKI 155 N L++F + PF+T L GL+ N EG TA+ CG + Sbjct: 55 NTFLDRFVAQVLHPFKTFPCTKLRDFGLYGNVEGSKTAMNWNCGSL 100 >At5g49820.1 68418.m06170 expressed protein contains Pfam domain, PF04884: Protein of unknown function, DUF647 Length = 497 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/39 (38%), Positives = 21/39 (53%) Query: 232 PPLEDGNIPEKLYTFEPDICRSLFASLVGKDTLFNISTY 270 P L++GNI EK++TF R + KD + STY Sbjct: 336 PSLQEGNIQEKIFTFPWVDDRPVMLGARFKDAFQDPSTY 374 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.320 0.138 0.422 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,758,309 Number of Sequences: 28952 Number of extensions: 414926 Number of successful extensions: 779 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 778 Number of HSP's gapped (non-prelim): 2 length of query: 412 length of database: 12,070,560 effective HSP length: 83 effective length of query: 329 effective length of database: 9,667,544 effective search space: 3180621976 effective search space used: 3180621976 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -