GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001299-TA|BGIBMGA001299-PA|IPR013057|Amino acid
transporter, transmembrane
         (429 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY500851-1|AAS77205.1|  605|Anopheles gambiae G-protein coupled ...    25   3.0  

>AY500851-1|AAS77205.1|  605|Anopheles gambiae G-protein coupled
           receptor 3 protein.
          Length = 605

 Score = 25.4 bits (53), Expect = 3.0
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 158 LKYLVPFSAIANALIFLVFAITLYYMFFDLPP 189
           ++ L P ++ AN LI+ +F+  +  M   LPP
Sbjct: 495 IQSLAPLNSAANPLIYCLFSTQVCRMIKRLPP 526


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.328    0.141    0.420 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 376,963
Number of Sequences: 2123
Number of extensions: 13266
Number of successful extensions: 92
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 91
Number of HSP's gapped (non-prelim): 1
length of query: 429
length of database: 516,269
effective HSP length: 66
effective length of query: 363
effective length of database: 376,151
effective search space: 136542813
effective search space used: 136542813
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 49 (23.8 bits)