BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001297-TA|BGIBMGA001297-PA|undefined (522 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 25 1.7 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 23 3.9 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 23 5.2 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 5.2 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 9.0 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 24.6 bits (51), Expect = 1.7 Identities = 14/44 (31%), Positives = 20/44 (45%) Query: 197 ENNNGTSKDIRHKPRKTKRKSRDERRDTNANGRDVSPKVFKTGS 240 E+NNG+S + + K KS D R N++ P GS Sbjct: 719 ESNNGSSPSVLNAIEKLIEKSFDSRSRQNSSFPGHGPTTAPMGS 762 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 23.4 bits (48), Expect = 3.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 289 LDRFGARRTEKIYLQGGGTF 308 LD+ GA + +Y GGGTF Sbjct: 13 LDKKGAEQNILVYDLGGGTF 32 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 23.0 bits (47), Expect = 5.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 199 NNGTSKDIRHKPRKTKRKSRD 219 NNGT+K++R T+ K+ D Sbjct: 115 NNGTNKNMRRLSTTTQNKNDD 135 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 23.0 bits (47), Expect = 5.2 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Query: 198 NNNGTSKDIRHKPRKTKRKSRDERRDTNANGRDVSPKVFKTGSKSK 243 NNN + R KRK+ D+ + VSP+V K S+ + Sbjct: 89 NNNNVVSSTNQEIRGPKRKTWKVEEDSPSPTSSVSPEV-KDSSRDR 133 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.2 bits (45), Expect = 9.0 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 456 PLVHNITGNLTTPTIPT-FYHTWTHFSIW 483 P +H TG+ ++PTI + Y + SIW Sbjct: 191 PQLHVSTGSTSSPTIASATYTNSANSSIW 219 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.133 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,299 Number of Sequences: 317 Number of extensions: 4857 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 5 length of query: 522 length of database: 114,650 effective HSP length: 60 effective length of query: 462 effective length of database: 95,630 effective search space: 44181060 effective search space used: 44181060 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -