BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001295-TA|BGIBMGA001295-PA|undefined (161 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 2.0 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 24 2.7 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 24.2 bits (50), Expect = 2.0 Identities = 11/37 (29%), Positives = 16/37 (43%) Query: 56 PSLVSRAHRSGRRRTTLCHCEHGTREQQDGRHALCSP 92 P + H RT+L + + EQ+ RH SP Sbjct: 1094 PRVADNQHNQDNDRTSLYSARNTSEEQRGRRHPTPSP 1130 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.8 bits (49), Expect = 2.7 Identities = 13/40 (32%), Positives = 19/40 (47%) Query: 50 ILTHKTPSLVSRAHRSGRRRTTLCHCEHGTREQQDGRHAL 89 +L + P L +R +GR L G ++QDG H L Sbjct: 586 LLKREFPDLQNRTIFTGRFVKELYDVRSGCVQEQDGTHLL 625 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.326 0.136 0.453 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,305 Number of Sequences: 2123 Number of extensions: 5097 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 161 length of database: 516,269 effective HSP length: 59 effective length of query: 102 effective length of database: 391,012 effective search space: 39883224 effective search space used: 39883224 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -