BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001294-TA|BGIBMGA001294-PA|undefined
(622 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 25 2.1
>AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase
protein.
Length = 580
Score = 24.6 bits (51), Expect = 2.1
Identities = 12/41 (29%), Positives = 18/41 (43%)
Query: 244 LNLDKLEDIDEAVHLVQETKSVQGAKMVANYFQNSDDSSSA 284
+N D + IDE VH + T V ++F D + A
Sbjct: 482 INYDLPKSIDEYVHRIGRTGRVGNKGKATSFFDEDQDRNLA 522
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.320 0.132 0.388
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,770
Number of Sequences: 317
Number of extensions: 3499
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 622
length of database: 114,650
effective HSP length: 61
effective length of query: 561
effective length of database: 95,313
effective search space: 53470593
effective search space used: 53470593
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 46 (22.6 bits)
- SilkBase 1999-2023 -