BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001292-TA|BGIBMGA001292-PA|IPR001199|Cytochrome b5 (195 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 1.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 17 FFETLKTLFCQPFIYFVFVSTFVI-LYKFY 45 +F + LFC FI F F++ +Y FY Sbjct: 260 YFYYMHLLFCCAFIIFTMHLLFLLCIYYFY 289 Score = 21.0 bits (42), Expect = 6.5 Identities = 8/26 (30%), Positives = 14/26 (53%) Query: 20 TLKTLFCQPFIYFVFVSTFVILYKFY 45 T+ LFC FI+F F++ ++ Sbjct: 177 TMHLLFCCAFIFFNMHLLFLLCLDYF 202 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 2.1 Identities = 7/23 (30%), Positives = 14/23 (60%) Query: 72 ELRQYDGTQEGGRVLMAVNGWIF 94 +L +Y+ +EG +V+ + W F Sbjct: 626 DLLEYEAKEEGPKVVCYMTNWAF 648 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.6 Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 127 TAPEKDYDDLSDLNSMEMESVREWEEQFRENYDLV 161 T P+ DDL + +E VR+ E +F + +++ Sbjct: 1200 TVPQNKRDDLVNPYWIEDPDVRKGEVEFLSSTEIL 1234 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.6 Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 127 TAPEKDYDDLSDLNSMEMESVREWEEQFRENYDLV 161 T P+ DDL + +E VR+ E +F + +++ Sbjct: 1200 TVPQNKRDDLVNPYWIEDPDVRKGEVEFLSSTEIL 1234 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.6 Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 127 TAPEKDYDDLSDLNSMEMESVREWEEQFRENYDLV 161 T P+ DDL + +E VR+ E +F + +++ Sbjct: 1200 TVPQNKRDDLVNPYWIEDPDVRKGEVEFLSSTEIL 1234 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.6 Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 127 TAPEKDYDDLSDLNSMEMESVREWEEQFRENYDLV 161 T P+ DDL + +E VR+ E +F + +++ Sbjct: 1200 TVPQNKRDDLVNPYWIEDPDVRKGEVEFLSSTEIL 1234 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.137 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,361 Number of Sequences: 317 Number of extensions: 2074 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 195 length of database: 114,650 effective HSP length: 54 effective length of query: 141 effective length of database: 97,532 effective search space: 13752012 effective search space used: 13752012 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -