BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001292-TA|BGIBMGA001292-PA|IPR001199|Cytochrome b5 (195 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52240.1 68418.m06484 cytochrome b5 domain-containing protein... 101 3e-22 At3g48890.1 68416.m05341 cytochrome b5 domain-containing protein... 97 9e-21 At2g24940.1 68415.m02982 cytochrome b5 domain-containing protein... 85 3e-17 At4g14965.1 68417.m02300 cytochrome b5 domain-containing protein... 74 7e-14 At3g46960.1 68416.m05099 DEAD/DEAH box helicase, putative simila... 31 0.39 At4g11750.1 68417.m01874 kelch repeat-containing F-box family pr... 30 1.2 At1g76780.1 68414.m08935 expressed protein ; expression supporte... 29 1.6 At5g45960.1 68418.m05651 GDSL-motif lipase/hydrolase family prot... 29 2.1 At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50... 29 2.1 At1g01010.1 68414.m00001 no apical meristem (NAM) family protein... 28 3.6 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 28 4.8 At3g52220.1 68416.m05737 expressed protein 27 8.4 At1g22230.1 68414.m02779 expressed protein ; expression supporte... 27 8.4 >At5g52240.1 68418.m06484 cytochrome b5 domain-containing protein similar to SP|P70580 Membrane associated progesterone receptor component 1 {Rattus norvegicus}; contains Pfam profile PF00173: Heme/Steroid binding domain Length = 220 Score = 101 bits (242), Expect = 3e-22 Identities = 51/116 (43%), Positives = 71/116 (61%), Gaps = 3/116 (2%) Query: 67 DMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV 126 ++T EL+QYDG+ +LMA+ I+DVT+ FYGPGGPYA+F G+DA+R LA S Sbjct: 74 EITEEELKQYDGSDPQKPLLMAIKHQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSF 133 Query: 127 TAPEKDYD-DLSDLNSMEMESVREWEEQFRENYDLVGRLLRPGEEPRNYSDEEPEE 181 EKD D+S L E++++++WE +F Y VG + G EP S EP E Sbjct: 134 --EEKDLTWDVSGLGPFELDALQDWEYKFMSKYAKVGTVKVAGSEPETASVSEPTE 187 >At3g48890.1 68416.m05341 cytochrome b5 domain-containing protein similar to SP|O00264 Membrane associated progesterone receptor component (mPR) {Homo sapiens}; contains Pfam profile PF00173: Heme/Steroid binding domain Length = 233 Score = 96.7 bits (230), Expect = 9e-21 Identities = 48/120 (40%), Positives = 74/120 (61%), Gaps = 3/120 (2%) Query: 67 DMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV 126 ++T EL+ YDG+ +LMA+ G I+DV++ FYGPGGPYA+F G+DA+R LA S Sbjct: 70 EITEEELKLYDGSDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSF 129 Query: 127 TAPEKDYDDLSDLNSMEMESVREWEEQFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSA 186 + D+S L + E+E++++WE +F Y VG + + E + S EP EA T++ Sbjct: 130 EDQDLT-GDISGLGAFELEALQDWEYKFMSKYVKVGTIQKKDGEGKESS--EPSEAKTAS 186 >At2g24940.1 68415.m02982 cytochrome b5 domain-containing protein similar to SP|P70580 Membrane associated progesterone receptor component 1 {Rattus norvegicus}; contains Pfam profile PF00173: Heme/Steroid binding domain Length = 100 Score = 85.0 bits (201), Expect = 3e-17 Identities = 40/100 (40%), Positives = 60/100 (60%), Gaps = 3/100 (3%) Query: 67 DMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV 126 + TA +L QY+GT E + +A+ G +FDVT G FYG GG Y++F G+DA+R L S Sbjct: 2 EFTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMSK 61 Query: 127 TAPEKDYD-DLSDLNSMEMESVREWEEQFRENYDLVGRLL 165 E+D L L E+ ++ +WE +F Y +VGR++ Sbjct: 62 N--EEDVSPSLEGLTEKEINTLNDWETKFEAKYPVVGRVV 99 >At4g14965.1 68417.m02300 cytochrome b5 domain-containing protein similar to SP|O15173 Membrane associated progesterone receptor component 2 (Steroid receptor protein DG6) {Homo sapiens}; contains Pfam profile PF00173: Heme/Steroid binding domain Length = 245 Score = 73.7 bits (173), Expect = 7e-14 Identities = 45/134 (33%), Positives = 70/134 (52%), Gaps = 7/134 (5%) Query: 32 FVFVSTFVILYKFYYKYKTHCSKVAPLKKLPKLRKDMTAVELRQYDGTQEGGRVLMAVNG 91 FV V+ V+L Y++ + K+L +A EL Y+GT E +L+ + G Sbjct: 12 FVGVTFIVVLVSLYFRSSFKSPQHQYQKRL------FSAEELALYNGTDETLPILLGILG 65 Query: 92 WIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEKDYDDLSDLNSMEMESVREWE 151 +FDVT+G YG GG Y F GRDA+R + + T + D L L+S E++S+ +W Sbjct: 66 SVFDVTKGKFHYGSGGGYNHFAGRDASRAFVSGNFTG-DGLTDSLQGLSSSEVKSIVDWR 124 Query: 152 EQFRENYDLVGRLL 165 + Y VG+L+ Sbjct: 125 GFYSRTYTPVGKLV 138 >At3g46960.1 68416.m05099 DEAD/DEAH box helicase, putative similar to SP|P35207 Antiviral protein SKI2 {Saccharomyces cerevisiae}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1347 Score = 31.5 bits (68), Expect = 0.39 Identities = 24/65 (36%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Query: 107 GPYAVFGGRDATRGL-ATFSVTAPEKD-YDDLSDLNSMEMESVREWEEQFRENYDLVGRL 164 G Y GR RGL T +V +D D SDL + + S E QFR Y ++ L Sbjct: 769 GEYTQMAGRAGRRGLDKTGTVVVMCRDEVPDESDLRRVIVGSATRLESQFRLTYIMILHL 828 Query: 165 LRPGE 169 LR E Sbjct: 829 LRVEE 833 >At4g11750.1 68417.m01874 kelch repeat-containing F-box family protein contains F-box domain Pfam:PF00646 and Kelch motif Pfam:PF01344 Length = 386 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/21 (66%), Positives = 14/21 (66%) Query: 58 LKKLPKLRKDMTAVELRQYDG 78 LKKLPKL KD T V L Y G Sbjct: 304 LKKLPKLPKDCTCVRLLGYSG 324 >At1g76780.1 68414.m08935 expressed protein ; expression supported by MPSS Length = 1871 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/47 (31%), Positives = 24/47 (51%) Query: 147 VREWEEQFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDDKK 193 VR+ E Q ++N G+ N +DEEP + +T A N+ +K Sbjct: 1682 VRKIEVQRKDNDQSFVEKDTSGKAKENLNDEEPTKTETKATDNESRK 1728 >At5g45960.1 68418.m05651 GDSL-motif lipase/hydrolase family protein Length = 375 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/38 (28%), Positives = 22/38 (57%) Query: 34 FVSTFVILYKFYYKYKTHCSKVAPLKKLPKLRKDMTAV 71 +VS + L+ F+ + + SK+ P K PK + ++A+ Sbjct: 11 YVSFILFLFLFFISFSSSTSKLEPAKSEPKRKHSVSAI 48 >At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50) identical to DNA repair-recombination protein GI:7110148 from [Arabidopsis thaliana] Length = 1316 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/40 (30%), Positives = 22/40 (55%) Query: 130 EKDYDDLSDLNSMEMESVREWEEQFRENYDLVGRLLRPGE 169 ++ Y L + N +E ++EW+ +F E L+G +R E Sbjct: 288 QRQYAALPEENEDTIEELKEWKSKFEERLALLGTKIRKME 327 >At1g01010.1 68414.m00001 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; similar to NAC domain protein NAM GB: AAD17313 GI:4325282 from [Arabidopsis thaliana] Length = 429 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 6/67 (8%) Query: 132 DYDDLSD----LNSMEMESVREWEEQFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSAL 187 DY DL L E ES W+ EN++ + + ++YSD P++ + L Sbjct: 246 DYIDLQQQVPYLAPYENESEMIWKHVIEENFEFL--VDERTSMQQHYSDHRPKKPVSGVL 303 Query: 188 PNDDKKT 194 P+D T Sbjct: 304 PDDSSDT 310 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Query: 19 ETLKTLFCQPFIYFVFVSTFVILYKFYYKYKTHCSKVAPL 58 E +K + + VF S +L +FY + HC K+AP+ Sbjct: 372 EPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPI 411 >At3g52220.1 68416.m05737 expressed protein Length = 237 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/25 (40%), Positives = 16/25 (64%) Query: 166 RPGEEPRNYSDEEPEEADTSALPND 190 RP E+P + + E+AD++ LP D Sbjct: 137 RPWEDPSTLASSQKEDADSARLPAD 161 >At1g22230.1 68414.m02779 expressed protein ; expression supported by MPSS Length = 314 Score = 27.1 bits (57), Expect = 8.4 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Query: 147 VREW-EEQFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDDKKTN 195 V+ W EE+ E + R+ + GEE D + D +L ++KK N Sbjct: 226 VKNWSEEKKEETEEGDNRVKQSGEEEEEEKDRVGNKKDLRSLMEEEKKMN 275 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.137 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,123,106 Number of Sequences: 28952 Number of extensions: 222004 Number of successful extensions: 623 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 608 Number of HSP's gapped (non-prelim): 14 length of query: 195 length of database: 12,070,560 effective HSP length: 77 effective length of query: 118 effective length of database: 9,841,256 effective search space: 1161268208 effective search space used: 1161268208 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -