BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001290-TA|BGIBMGA001290-PA|IPR002083|MATH, IPR008974|TRAF-like (359 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 1.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 1.1 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 2.6 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 23 2.6 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 4.5 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/42 (30%), Positives = 22/42 (52%) Query: 167 ALYERVVVLEQRNREQDIVIANISKQLSAFAVAKMKQNNEML 208 A++ R N + + IA+I+ Q S+F V + +NN L Sbjct: 202 AMFSRKPCSINENLKMGLDIASITAQASSFVVWPLVENNPTL 243 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/42 (30%), Positives = 22/42 (52%) Query: 167 ALYERVVVLEQRNREQDIVIANISKQLSAFAVAKMKQNNEML 208 A++ R N + + IA+I+ Q S+F V + +NN L Sbjct: 202 AMFSRKPCSINENLKMGLDIASITAQASSFVVWPLVENNPTL 243 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.4 bits (48), Expect = 2.6 Identities = 15/65 (23%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Query: 163 ALIRALYERVVVLEQRNR-----EQDIVIANISKQLSAFAVAKMKQNNEMLLRYCMGNYV 217 AL++A V++ R + + + N ++ +A M + E LL +C Y Sbjct: 389 ALLKACSSEVMMFRMARRYDVQTDSILFVNNQPYSRDSYNLAGMGETIEDLLHFCRTMYS 448 Query: 218 WRIDN 222 ++DN Sbjct: 449 MKVDN 453 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 23.4 bits (48), Expect = 2.6 Identities = 10/34 (29%), Positives = 19/34 (55%) Query: 105 NDTQSHMNLLMNAYSEMKINNDMSNANMDTKEQE 138 NDT S ++ L N Y M + N++ + ++ Q+ Sbjct: 318 NDTPSILHELRNNYFHMDLENNVQSYSLQLLHQK 351 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 4.5 Identities = 8/20 (40%), Positives = 15/20 (75%) Query: 168 LYERVVVLEQRNREQDIVIA 187 +Y+RVV L ++N + I++A Sbjct: 576 MYDRVVALREKNPDLKILLA 595 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.133 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,440 Number of Sequences: 317 Number of extensions: 3952 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 8 length of query: 359 length of database: 114,650 effective HSP length: 58 effective length of query: 301 effective length of database: 96,264 effective search space: 28975464 effective search space used: 28975464 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -