BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001288-TA|BGIBMGA001288-PA|undefined (303 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 4.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 4.9 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 6.4 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/36 (16%), Positives = 17/36 (47%) Query: 236 VEEHSRVCEKNMWKSFLFIHNYFGFEEMTSQRLDRH 271 +++ ++ K W ++++ GF + + L H Sbjct: 111 LKDKKKIRAKKRWSQCMYMYFLLGFRYLVNDELSAH 146 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/36 (16%), Positives = 17/36 (47%) Query: 236 VEEHSRVCEKNMWKSFLFIHNYFGFEEMTSQRLDRH 271 +++ ++ K W ++++ GF + + L H Sbjct: 425 LKDKKKIRAKKRWSQCMYMYFLLGFRYLVNDELSAH 460 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Query: 83 DDKDGVTNFEKLLNAFSLKRNLRKVF 108 DD+D FE L N + +N R++F Sbjct: 33 DDRDLWLRFECLTNEMIVTKNGRRMF 58 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.325 0.138 0.428 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,736 Number of Sequences: 317 Number of extensions: 2728 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 3 length of query: 303 length of database: 114,650 effective HSP length: 57 effective length of query: 246 effective length of database: 96,581 effective search space: 23758926 effective search space used: 23758926 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -