BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001287-TA|BGIBMGA001287-PA|undefined (104 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 21 3.4 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 20 5.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 20 5.9 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 19 7.9 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 19 7.9 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 20.6 bits (41), Expect = 3.4 Identities = 8/31 (25%), Positives = 17/31 (54%) Query: 17 VLSRDCIELTISDKRIITETILNSTILKFQH 47 VL + ++ +++++ E LNS + QH Sbjct: 8 VLVKSMLQRIKMEEKLVVEKFLNSLQIYLQH 38 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 19.8 bits (39), Expect = 5.9 Identities = 7/27 (25%), Positives = 12/27 (44%) Query: 77 TSEQCRRDSQLYMDSLDRLELWALKNY 103 + + C D D ++L+ L NY Sbjct: 112 SQDSCHADKSCASDDKSPIDLYTLINY 138 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 19.8 bits (39), Expect = 5.9 Identities = 7/13 (53%), Positives = 11/13 (84%) Query: 25 LTISDKRIITETI 37 LT +D+R++T TI Sbjct: 14 LTPTDQRVVTRTI 26 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 19.4 bits (38), Expect = 7.9 Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 37 ILNSTILKFQHENDTVVESSRFNIVQ 62 +L ST LK+Q + + F+I+Q Sbjct: 122 LLTSTGLKWQTRRKILTPAFHFSILQ 147 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 19.4 bits (38), Expect = 7.9 Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 37 ILNSTILKFQHENDTVVESSRFNIVQ 62 +L ST LK+Q + + F+I+Q Sbjct: 122 LLTSTGLKWQTRRKILTPAFHFSILQ 147 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.134 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,037 Number of Sequences: 317 Number of extensions: 727 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 104 length of database: 114,650 effective HSP length: 49 effective length of query: 55 effective length of database: 99,117 effective search space: 5451435 effective search space used: 5451435 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.6 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -