SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001287-TA|BGIBMGA001287-PA|undefined
         (104 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ010194-1|CAA09033.1|  684|Anopheles gambiae prophenoloxidase p...    23   1.7  

>AJ010194-1|CAA09033.1|  684|Anopheles gambiae prophenoloxidase
           protein.
          Length = 684

 Score = 23.4 bits (48), Expect = 1.7
 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 67  FPKVVVPRNGTSEQCRRDSQLYMDSLDRLE 96
           FPK+V   +G +  CR  +Q+ M  ++R+E
Sbjct: 272 FPKIVRSSDGRAFSCRYPNQV-MKDVNRVE 300


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.322    0.134    0.394 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 99,483
Number of Sequences: 2123
Number of extensions: 3378
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 104
length of database: 516,269
effective HSP length: 55
effective length of query: 49
effective length of database: 399,504
effective search space: 19575696
effective search space used: 19575696
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 42 (21.0 bits)

- SilkBase 1999-2023 -