SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001285-TA|BGIBMGA001285-PA|undefined
         (79 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_26267| Best HMM Match : TSP_C (HMM E-Value=0)                       27   2.8  

>SB_26267| Best HMM Match : TSP_C (HMM E-Value=0)
          Length = 2996

 Score = 26.6 bits (56), Expect = 2.8
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 14  PIYHMRPFGTGLKVQGNQLLGTFKSSYSMLDAI 46
           P Y   P+G+ L +  N L+ TF SS+   DA+
Sbjct: 915 PTYIASPYGSWLAISANPLIDTF-SSWFRPDAV 946


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.320    0.138    0.415 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,575,466
Number of Sequences: 59808
Number of extensions: 85572
Number of successful extensions: 128
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 127
Number of HSP's gapped (non-prelim): 1
length of query: 79
length of database: 16,821,457
effective HSP length: 57
effective length of query: 22
effective length of database: 13,412,401
effective search space: 295072822
effective search space used: 295072822
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 52 (25.0 bits)

- SilkBase 1999-2023 -