BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001284-TA|BGIBMGA001284-PA|undefined (242 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 25 0.83 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 2.5 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 24.6 bits (51), Expect = 0.83 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Query: 115 DGWELGIPDNNRQVPKDQWFDMHASD 140 DG L + DN+ + KD WF HASD Sbjct: 157 DGVTL-LADNSVSI-KDPWFPRHASD 180 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 23.0 bits (47), Expect = 2.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Query: 171 EKKVKHITYQLTTDIWSTNPSYCSKLVIQA 200 E +HI + TD +T P Y S VI A Sbjct: 421 EDDARHIPHASVTDSENTVPRYLSPDVISA 450 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.137 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,365 Number of Sequences: 429 Number of extensions: 3552 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 242 length of database: 140,377 effective HSP length: 56 effective length of query: 186 effective length of database: 116,353 effective search space: 21641658 effective search space used: 21641658 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -