BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001284-TA|BGIBMGA001284-PA|undefined (242 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 6.5 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 21 8.6 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.4 bits (43), Expect = 6.5 Identities = 5/15 (33%), Positives = 10/15 (66%) Query: 106 YWVLEMPGGDGWELG 120 +W++ P G +E+G Sbjct: 313 FWIIVAPAGSNFEIG 327 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/35 (25%), Positives = 16/35 (45%) Query: 74 REFINTVKKGDVLITGRGVGGLIGHAAIMTSDYWV 108 + FI + D+ ITG+ + + DY+V Sbjct: 365 QRFIQQIGNSDIAITGKNFFSITRGLILSFVDYFV 399 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.137 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,041 Number of Sequences: 317 Number of extensions: 2799 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 242 length of database: 114,650 effective HSP length: 55 effective length of query: 187 effective length of database: 97,215 effective search space: 18179205 effective search space used: 18179205 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -