GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001283-TA|BGIBMGA001283-PA|IPR006958|Mak16 protein
         (209 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein.    25   2.2  

>AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein.
          Length = 1229

 Score = 24.6 bits (51), Expect = 2.2
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 9   QWEKVKLSRNFEKAIHQINENLLYWPAFIKAKCKQRFVKITQ 50
           Q E+ K    FE+ I +IN NL +  +   +K  QR+ +  Q
Sbjct: 812 QQERAKKRAEFEQQIDRINNNLEFERSKDTSKNVQRWERAVQ 853


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.323    0.136    0.383 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 131,387
Number of Sequences: 2123
Number of extensions: 3466
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 209
length of database: 516,269
effective HSP length: 61
effective length of query: 148
effective length of database: 386,766
effective search space: 57241368
effective search space used: 57241368
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 46 (22.6 bits)