BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001278-TA|BGIBMGA001278-PA|IPR001365|Adenosine/AMP deaminase (303 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 25 1.1 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 23 2.5 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 24.6 bits (51), Expect = 1.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Query: 132 NPAVGNFGDFIPALNRARQSGLKVTL 157 +P G DF + RA+ GLKV L Sbjct: 93 DPVYGTLADFDRLVRRAKSLGLKVIL 118 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 23.4 bits (48), Expect = 2.5 Identities = 9/36 (25%), Positives = 19/36 (52%) Query: 184 CIHPKYGGTEETWIALCQSKIPVEVCLTSNVNTKIT 219 C++P + W+ + + ++VC ++VN IT Sbjct: 110 CVNPYDRDSLSCWLQMTKHHNFIKVCSVNDVNMTIT 145 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,957 Number of Sequences: 429 Number of extensions: 3025 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 303 length of database: 140,377 effective HSP length: 57 effective length of query: 246 effective length of database: 115,924 effective search space: 28517304 effective search space used: 28517304 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -