GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001273-TA|BGIBMGA001273-PA|IPR012776|Trimethyllysine
dioxygenase, IPR003819|Taurine catabolism dioxygenase TauD/TfdA
         (232 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein ...    25   1.4  

>AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein L5
           protein.
          Length = 327

 Score = 25.4 bits (53), Expect = 1.4
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 2/69 (2%)

Query: 147 YDRSAMAFRSGRDCRLYYRSLKNLARYYENKENQWIFKLVPGLVMVIDNFRLLHGRNGFT 206
           + R  + FR  R+ +  Y + K L    +NK N   F+L+  L       ++ + R    
Sbjct: 13  FKRYQVRFRRRREGKTDYYARKRLIFQDKNKYNTPKFRLIVRLSNRDITCQIAYRR--IE 70

Query: 207 GRRVLCGAY 215
           G R++C AY
Sbjct: 71  GDRIVCAAY 79


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.322    0.137    0.428 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 267,056
Number of Sequences: 2123
Number of extensions: 11825
Number of successful extensions: 16
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 16
Number of HSP's gapped (non-prelim): 1
length of query: 232
length of database: 516,269
effective HSP length: 62
effective length of query: 170
effective length of database: 384,643
effective search space: 65389310
effective search space used: 65389310
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 47 (23.0 bits)