BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001272-TA|BGIBMGA001272-PA|IPR002469|Peptidase S9B, dipeptidylpeptidase IV N-terminal, IPR001375|Peptidase S9, prolyl oligopeptidase active site region (737 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 23 9.9 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 23 9.9 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 22.6 bits (46), Expect = 9.9 Identities = 10/47 (21%), Positives = 22/47 (46%) Query: 236 YLNNIFYQSSLTAAPQQITTTGEINVIYHGVPDWVYEEEVFSSNNAM 282 Y +FY + + +TTT ++ G + +F++N+A+ Sbjct: 227 YSKKVFYSKIIISGSIFMTTTSFYRILNSGYNLTTFGSFIFNANSAI 273 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.6 bits (46), Expect = 9.9 Identities = 16/51 (31%), Positives = 23/51 (45%) Query: 454 STGRTNTAHTVSEILHWSPNDIIWYRATRVNDPAEQHIYTVNSAREVACFT 504 STG T++ S S N IW A+ + EQH +S++ V T Sbjct: 196 STGSTSSPTIASATYTNSANSSIWSPASIDSFTLEQHRSWCSSSQPVLSTT 246 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.132 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,282 Number of Sequences: 317 Number of extensions: 7205 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 2 length of query: 737 length of database: 114,650 effective HSP length: 62 effective length of query: 675 effective length of database: 94,996 effective search space: 64122300 effective search space used: 64122300 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -