BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001270-TA|BGIBMGA001270-PA|undefined (381 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2... 31 0.20 SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex lar... 28 2.5 SPBC18E5.02c ||SPBC29A3.20c|serine palmitoyltransferase complex ... 27 3.3 SPAC24C9.11 |||MIF4G/MA4 domain protein|Schizosaccharomyces pomb... 27 3.3 SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pom... 27 5.8 SPBC1348.14c |ght7|SPBPB8B6.01c|hexose transporter Ght7|Schizosa... 27 5.8 >SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 683 Score = 31.5 bits (68), Expect = 0.20 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Query: 310 WRIWNGGPFRSPGLNAIALYVGHSLCAHLFPFHWK-IPNMETHTIKLLEAVWGTALWV 366 W ++ GG PGL AIA G + + FH + IP E H++ + ++LW+ Sbjct: 326 WGVFKGG---EPGLFAIAENYGKQILFFVSIFHHQVIPMTEEHSVSSISVPKSSSLWL 380 >SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex large subunit Nuc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1689 Score = 27.9 bits (59), Expect = 2.5 Identities = 15/44 (34%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Query: 69 RSIMMFFLGMSLNTIYGSNVLQELRIFGV-LQRLAVAYLVAAGF 111 ++I F+ +S+N IY +++ LRI+GV R A+ + V++ F Sbjct: 1550 KAIWEFYNEISMNDIYTNDIAAILRIYGVEAARNAIVHEVSSVF 1593 >SPBC18E5.02c ||SPBC29A3.20c|serine palmitoyltransferase complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 509 Score = 27.5 bits (58), Expect = 3.3 Identities = 11/34 (32%), Positives = 23/34 (67%) Query: 210 YGGPPTDPEGLLGCVTSAVQALIGIQAGATVLLQ 243 +G PPTD E ++G +T+++ G AG+ ++++ Sbjct: 320 FGVPPTDVEIIIGSLTTSLAGGGGFCAGSELMVE 353 >SPAC24C9.11 |||MIF4G/MA4 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 27.5 bits (58), Expect = 3.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 15 GYWWMEHATWNGMVAGD 31 G WW+ A+WN + +GD Sbjct: 514 GRWWLVGASWNNVPSGD 530 >SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pombe|chr 1|||Manual Length = 986 Score = 26.6 bits (56), Expect = 5.8 Identities = 14/39 (35%), Positives = 19/39 (48%) Query: 209 VYGGPPTDPEGLLGCVTSAVQALIGIQAGATVLLQRSHK 247 + GP P G +G V V + I +G T LLQ S + Sbjct: 653 IRAGPSPLPNGFVGYVLPPVYKITQIHSGDTELLQLSQE 691 >SPBC1348.14c |ght7|SPBPB8B6.01c|hexose transporter Ght7|Schizosaccharomyces pombe|chr 2|||Manual Length = 518 Score = 26.6 bits (56), Expect = 5.8 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 3/80 (3%) Query: 141 WVLAIVLVTVHSVITF--IIHHPDCPPGYLGPGGKHDEWVAPECSGGAAGFIDRLILGES 198 W ++I + + +IT II P+ P YL GK DE + C +I E Sbjct: 148 WRISIGINLLWGIITLVGIIFLPESPR-YLIAIGKDDEALKIMCYNNDLPLEHEIIQTEY 206 Query: 199 HLYQRSDARNVYGGPPTDPE 218 H + + GGP PE Sbjct: 207 HTIKSDCDAELAGGPARWPE 226 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.328 0.141 0.479 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,713,811 Number of Sequences: 5004 Number of extensions: 68834 Number of successful extensions: 163 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 158 Number of HSP's gapped (non-prelim): 7 length of query: 381 length of database: 2,362,478 effective HSP length: 74 effective length of query: 307 effective length of database: 1,992,182 effective search space: 611599874 effective search space used: 611599874 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -