BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001270-TA|BGIBMGA001270-PA|undefined (381 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF100657-2|AAC68958.2| 1635|Caenorhabditis elegans Hypothetical ... 31 1.8 Z81109-13|CAB03254.2| 318|Caenorhabditis elegans Hypothetical p... 29 4.1 >AF100657-2|AAC68958.2| 1635|Caenorhabditis elegans Hypothetical protein F52C12.4 protein. Length = 1635 Score = 30.7 bits (66), Expect = 1.8 Identities = 10/17 (58%), Positives = 13/17 (76%) Query: 330 VGHSLCAHLFPFHWKIP 346 V S+CA +FPFHW+ P Sbjct: 471 VAESVCALMFPFHWQCP 487 >Z81109-13|CAB03254.2| 318|Caenorhabditis elegans Hypothetical protein R10D12.11 protein. Length = 318 Score = 29.5 bits (63), Expect = 4.1 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 2/68 (2%) Query: 56 GIPRWKIVMHIVRR-SIMMFFLGMSLNTIYGSNVLQELRIFGVLQRLAVAYLVAAGFYAL 114 GIP + IV+H S+ + L + T SN +++ + + + ++ + +L +AL Sbjct: 4 GIPGYVIVLHSCTAISVPVNLLAIFCITTQSSNTMKQYKWYLLNVQIWI-FLTDIILFAL 62 Query: 115 TAPKFYTP 122 AP+FY P Sbjct: 63 IAPRFYFP 70 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.328 0.141 0.479 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,506,323 Number of Sequences: 27539 Number of extensions: 391861 Number of successful extensions: 1096 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1095 Number of HSP's gapped (non-prelim): 2 length of query: 381 length of database: 12,573,161 effective HSP length: 83 effective length of query: 298 effective length of database: 10,287,424 effective search space: 3065652352 effective search space used: 3065652352 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -