GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001269-TA|BGIBMGA001269-PA|IPR000008|C2
calcium-dependent membrane targeting, IPR008973|C2
calcium/lipid-binding region, CaLB, IPR001683|Phox-like
         (207 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y17704-1|CAA76824.2|  401|Anopheles gambiae hypothetical protein...    23   5.0  

>Y17704-1|CAA76824.2|  401|Anopheles gambiae hypothetical protein
           protein.
          Length = 401

 Score = 23.4 bits (48), Expect = 5.0
 Identities = 10/34 (29%), Positives = 17/34 (50%)

Query: 89  VQYAGGVLSVLILHAQSLALTPQGAPPNPYVKVY 122
           V +AG +L+  ++H   L      A   PY+ +Y
Sbjct: 31  VSHAGAILTAPLIHCHPLKACDGEAILKPYLALY 64


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.320    0.136    0.399 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 191,175
Number of Sequences: 2123
Number of extensions: 6473
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 1
length of query: 207
length of database: 516,269
effective HSP length: 61
effective length of query: 146
effective length of database: 386,766
effective search space: 56467836
effective search space used: 56467836
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 46 (22.6 bits)