BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001269-TA|BGIBMGA001269-PA|IPR000008|C2
calcium-dependent membrane targeting, IPR008973|C2
calcium/lipid-binding region, CaLB, IPR001683|Phox-like
(207 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein... 23 5.0
>Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein
protein.
Length = 401
Score = 23.4 bits (48), Expect = 5.0
Identities = 10/34 (29%), Positives = 17/34 (50%)
Query: 89 VQYAGGVLSVLILHAQSLALTPQGAPPNPYVKVY 122
V +AG +L+ ++H L A PY+ +Y
Sbjct: 31 VSHAGAILTAPLIHCHPLKACDGEAILKPYLALY 64
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.320 0.136 0.399
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 191,175
Number of Sequences: 2123
Number of extensions: 6473
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 1
length of query: 207
length of database: 516,269
effective HSP length: 61
effective length of query: 146
effective length of database: 386,766
effective search space: 56467836
effective search space used: 56467836
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 46 (22.6 bits)
- SilkBase 1999-2023 -