BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001264-TA|BGIBMGA001264-PA|IPR009072|Histone-fold (254 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 24 1.3 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 23 2.3 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/37 (29%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Query: 27 QMKLWFRMKLTKEEFDGEARKLLSNDQVH--FHNEFL 61 Q+K+WF+ + KE + +++ Q+ FHN F+ Sbjct: 200 QIKIWFQNRRAKERKQNK-KRIEEKSQIDNLFHNGFM 235 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/34 (32%), Positives = 18/34 (52%) Query: 176 NVISAVLAQRKGYKTHGKYFMYDIGGDMPNMWLR 209 N +SAV Q +GY T+ + G+ P + L+ Sbjct: 380 NNVSAVTTQHQGYPTNTVTILGPNSGNTPKILLQ 413 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,972 Number of Sequences: 317 Number of extensions: 2024 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 254 length of database: 114,650 effective HSP length: 55 effective length of query: 199 effective length of database: 97,215 effective search space: 19345785 effective search space used: 19345785 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -