GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001263-TA|BGIBMGA001263-PA|IPR002559|Transposase, IS4
         (294 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY324310-1|AAQ89695.1|  160|Anopheles gambiae insulin-like pepti...    27   0.83 

>AY324310-1|AAQ89695.1|  160|Anopheles gambiae insulin-like
          peptide 4 precursor protein.
          Length = 160

 Score = 26.6 bits (56), Expect = 0.83
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 24 STTGLFSSVSASLIP-TFTDWKIIENGFREQWNFP 57
          +T   +S V+++  P +  DW   ENGF+   N P
Sbjct: 58 NTVEFYSPVTSNQFPGSQLDWDFSENGFKRNVNVP 92


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.321    0.138    0.437 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 307,293
Number of Sequences: 2123
Number of extensions: 13180
Number of successful extensions: 36
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 35
Number of HSP's gapped (non-prelim): 1
length of query: 294
length of database: 516,269
effective HSP length: 64
effective length of query: 230
effective length of database: 380,397
effective search space: 87491310
effective search space used: 87491310
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 48 (23.4 bits)