BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001262-TA|BGIBMGA001262-PA|IPR002048|Calcium-binding EF-hand (245 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic pr... 26 0.88 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 4.7 >AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic protein protein. Length = 109 Score = 26.2 bits (55), Expect = 0.88 Identities = 16/74 (21%), Positives = 35/74 (47%), Gaps = 5/74 (6%) Query: 32 KAVEDNSTPHVQSHVSEHSTAIESNKELPKEAVAPSTNAKDPISPIHSVHNSTEGKSNLT 91 K+++ ++TP + H+ T + +P + +A P ++N++ G++N T Sbjct: 7 KSLQLSTTP--EYHIP---TXVLDPLRVPNHTTVVAPSAVSPHQSSFMINNNSTGRTNFT 61 Query: 92 ILDNSTVRKEIDFN 105 + + KE FN Sbjct: 62 NKQLTELEKEFHFN 75 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 15/28 (53%) Query: 118 GGFALLAVAYFIFYRSKHKSNEANTMHS 145 GG +L A+F YR + K A M+S Sbjct: 195 GGLVVLLGAFFWVYRRREKRKPAYLMNS 222 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.310 0.128 0.353 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,501 Number of Sequences: 2123 Number of extensions: 6856 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 245 length of database: 516,269 effective HSP length: 62 effective length of query: 183 effective length of database: 384,643 effective search space: 70389669 effective search space used: 70389669 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -