BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001259-TA|BGIBMGA001259-PA|IPR004878|Protein of unknown function DUF270 (586 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 5.9 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.0 bits (47), Expect = 5.9 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 118 KRLSLGFALATRTHHYGSFYLRMGAVAFGIGSMIYSGLEF 157 ++ SL F HH+ S ++ +G+ +++ GL F Sbjct: 1295 RKKSLDFGKLCSLHHHLSKLIKSFNEIYGVPLLLFFGLNF 1334 Score = 22.6 bits (46), Expect = 7.7 Identities = 11/44 (25%), Positives = 20/44 (45%) Query: 114 QLPAKRLSLGFALATRTHHYGSFYLRMGAVAFGIGSMIYSGLEF 157 ++ K S+ HH+ S +R+ FG G ++ G+ F Sbjct: 841 KMETKAQSVALGKICTLHHHLSKLIRLFNEIFGHGLLLMFGISF 884 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.327 0.138 0.427 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,719 Number of Sequences: 317 Number of extensions: 5068 Number of successful extensions: 14 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 2 length of query: 586 length of database: 114,650 effective HSP length: 61 effective length of query: 525 effective length of database: 95,313 effective search space: 50039325 effective search space used: 50039325 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -