BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001257-TA|BGIBMGA001257-PA|IPR013027|FAD-dependent pyridine nucleotide-disulphide oxidoreductase (472 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 23 6.1 AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 23 6.1 AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esteras... 23 6.1 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 22.6 bits (46), Expect = 6.1 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 238 LENIKSDRGVQELEIVYKAEVESVLEDNKNEY 269 + + G+ L+ VY ++ + L+DN N+Y Sbjct: 316 IASFTKSEGLYHLDEVYNNQLLTRLDDNWNKY 347 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 22.6 bits (46), Expect = 6.1 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 238 LENIKSDRGVQELEIVYKAEVESVLEDNKNEY 269 + + G+ L+ VY ++ + L+DN N+Y Sbjct: 316 IASFTKSEGLYHLDEVYNNQLLTRLDDNWNKY 347 >AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 22.6 bits (46), Expect = 6.1 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 238 LENIKSDRGVQELEIVYKAEVESVLEDNKNEY 269 + + G+ L+ VY ++ + L+DN N+Y Sbjct: 316 IASFTKSEGLYHLDEVYNNQLLTRLDDNWNKY 347 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.135 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,728 Number of Sequences: 317 Number of extensions: 4105 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 3 length of query: 472 length of database: 114,650 effective HSP length: 59 effective length of query: 413 effective length of database: 95,947 effective search space: 39626111 effective search space used: 39626111 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -