BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001253-TA|BGIBMGA001253-PA|undefined
(127 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 2.5
>CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.
Length = 1664
Score = 23.4 bits (48), Expect = 2.5
Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 3/63 (4%)
Query: 12 KLSSENVISDSKIPISASSEAGIHKKPTLLSSDKMDNDANAQEKLTERKTMILPDKMTQS 71
K +S + + + P S + G+H+ PT+ S M A + T +PD +T+S
Sbjct: 955 KTTSTDSTNGLETPTSETVGGGMHRTPTVAS---MMTFMPAAGSSSGTATTRIPDSITRS 1011
Query: 72 KTV 74
+V
Sbjct: 1012 CSV 1014
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.311 0.125 0.343
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,808
Number of Sequences: 2123
Number of extensions: 2665
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 127
length of database: 516,269
effective HSP length: 57
effective length of query: 70
effective length of database: 395,258
effective search space: 27668060
effective search space used: 27668060
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 43 (21.4 bits)
- SilkBase 1999-2023 -