GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001253-TA|BGIBMGA001253-PA|undefined
         (127 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.           23   2.5  

>CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.
          Length = 1664

 Score = 23.4 bits (48), Expect = 2.5
 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 3/63 (4%)

Query: 12   KLSSENVISDSKIPISASSEAGIHKKPTLLSSDKMDNDANAQEKLTERKTMILPDKMTQS 71
            K +S +  +  + P S +   G+H+ PT+ S   M     A    +   T  +PD +T+S
Sbjct: 955  KTTSTDSTNGLETPTSETVGGGMHRTPTVAS---MMTFMPAAGSSSGTATTRIPDSITRS 1011

Query: 72   KTV 74
             +V
Sbjct: 1012 CSV 1014


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.311    0.125    0.343 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,808
Number of Sequences: 2123
Number of extensions: 2665
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 127
length of database: 516,269
effective HSP length: 57
effective length of query: 70
effective length of database: 395,258
effective search space: 27668060
effective search space used: 27668060
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 43 (21.4 bits)