BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001252-TA|BGIBMGA001252-PA|undefined (282 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31460.1 68417.m04470 ribosomal protein L28 family protein ri... 43 3e-04 At4g01800.1 68417.m00237 preprotein translocase secA subunit, pu... 31 1.2 At3g23670.1 68416.m02976 phragmoplast-associated kinesin-related... 30 1.5 At1g31070.2 68414.m03804 UDP-N-acetylglucosamine pyrophosphoryla... 29 4.6 At1g31070.1 68414.m03803 UDP-N-acetylglucosamine pyrophosphoryla... 29 4.6 At5g26760.2 68418.m03189 expressed protein 28 6.1 At5g26760.1 68418.m03188 expressed protein 28 6.1 At3g22790.1 68416.m02873 kinase interacting family protein simil... 28 6.1 At5g51270.1 68418.m06356 protein kinase family protein contains ... 28 8.1 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 28 8.1 At2g34250.1 68415.m04190 protein transport protein sec61, putati... 28 8.1 At1g58025.1 68414.m06576 DNA-binding bromodomain-containing prot... 28 8.1 >At4g31460.1 68417.m04470 ribosomal protein L28 family protein ribosomal protein YmL14 precursor, mitochondrial - Saccharomyces cerevisiae,PIR2:S50921 Length = 212 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/86 (25%), Positives = 42/86 (48%) Query: 87 GIWGGEAVVKGFQKRDDRRRRVPHYWVPVLKRTVVRSEVLNTHLSVTVTDRTISLINDHY 146 G++ G + G + +D + W P ++ + S + ++H+ V VT + I+ Sbjct: 46 GLYAGRHIQYGNRVSEDGGNKSRRCWKPNVQEKRLFSYIFDSHIKVKVTTHALRCIDKAG 105 Query: 147 GFDHYLLKTPACDLVSVLALKLKKQI 172 G D YLLKTP + + + L K ++ Sbjct: 106 GIDEYLLKTPYQKMDTEMGLYWKTKV 131 >At4g01800.1 68417.m00237 preprotein translocase secA subunit, putative similar to preprotein translocase secA subunit, chloroplast [precursor] SP:Q9SYI0 from [Arabidopsis thaliana]; non-consensus GA donor splice site at exon 4 Length = 1022 Score = 30.7 bits (66), Expect = 1.2 Identities = 25/119 (21%), Positives = 56/119 (47%), Gaps = 11/119 (9%) Query: 102 DDRRRRVPHYWVPVLKRTVVRSEVLNTHLSVTVTDRTISLINDHYGFDHYLLKTPACDLV 161 D+ +R+V +Y+ + K+ EVLN+ T+R +L++D + +++ + Sbjct: 774 DEAQRKVENYFFDIRKQLFEFDEVLNSQRDRVYTERRRALVSD--SLEPLIIEYAELTMD 831 Query: 162 SVLALKLKKQILTELMNGCPRHAYDPKKQMEIYEEYKTYLSSYTPEEIEWYGLTWYEAL 220 +L + P+ ++D +K + ++Y L+ TP+ ++ G + YE L Sbjct: 832 DILEANIGPD--------TPKESWDFEKLIAKVQQYCYLLNDLTPDLLKSEGSS-YEGL 881 >At3g23670.1 68416.m02976 phragmoplast-associated kinesin-related protein, putative similar to kinesin like protein GB:CAB10194 from [Arabidopsis thaliana] Length = 1313 Score = 30.3 bits (65), Expect = 1.5 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 7/71 (9%) Query: 218 EALSKVAKLKEAANKPIPLKNVYR----KNLVEKLKSAGIESKSSSADEISAT---TSWL 270 EA KV KLK I N +N +E L+++ + + DE SA+ W Sbjct: 1224 EAYKKVDKLKRKYETEISTVNQQHNAEPQNPIESLQASCNDDAMAKYDEPSASDGDNQWR 1283 Query: 271 SKMNPFGKKDE 281 + PF KKDE Sbjct: 1284 EEFQPFYKKDE 1294 >At1g31070.2 68414.m03804 UDP-N-acetylglucosamine pyrophosphorylase-related low similarity to SP|P43123 UDP-N-acetylglucosamine pyrophosphorylase (EC 2.7.7.23) {Saccharomyces cerevisiae} Length = 505 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/46 (36%), Positives = 23/46 (50%) Query: 219 ALSKVAKLKEAANKPIPLKNVYRKNLVEKLKSAGIESKSSSADEIS 264 AL+ A P P+ + R+ LVE+LK G E S DE+S Sbjct: 12 ALTAATTTTTAVTSPPPMASSPRQALVERLKDYGQEDIFSLWDELS 57 >At1g31070.1 68414.m03803 UDP-N-acetylglucosamine pyrophosphorylase-related low similarity to SP|P43123 UDP-N-acetylglucosamine pyrophosphorylase (EC 2.7.7.23) {Saccharomyces cerevisiae} Length = 153 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/46 (36%), Positives = 23/46 (50%) Query: 219 ALSKVAKLKEAANKPIPLKNVYRKNLVEKLKSAGIESKSSSADEIS 264 AL+ A P P+ + R+ LVE+LK G E S DE+S Sbjct: 12 ALTAATTTTTAVTSPPPMASSPRQALVERLKDYGQEDIFSLWDELS 57 >At5g26760.2 68418.m03189 expressed protein Length = 735 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/35 (31%), Positives = 21/35 (60%) Query: 140 SLINDHYGFDHYLLKTPACDLVSVLALKLKKQILT 174 ++++D YG ++ + K P C + L+ KLK + T Sbjct: 312 AMMSDGYGVEYSVSKQPQCSMEDSLSCKLKGDLQT 346 >At5g26760.1 68418.m03188 expressed protein Length = 430 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/35 (31%), Positives = 21/35 (60%) Query: 140 SLINDHYGFDHYLLKTPACDLVSVLALKLKKQILT 174 ++++D YG ++ + K P C + L+ KLK + T Sbjct: 7 AMMSDGYGVEYSVSKQPQCSMEDSLSCKLKGDLQT 41 >At3g22790.1 68416.m02873 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1694 Score = 28.3 bits (60), Expect = 6.1 Identities = 28/115 (24%), Positives = 54/115 (46%), Gaps = 5/115 (4%) Query: 158 CDLVSVLALKLKKQILTELMNGCPRHAYDPKKQMEIYEEYKTYLSSYTPEEIEWYGLTWY 217 CDL ++K IL+ L K+++ + + +LSS E+ +GL Sbjct: 1215 CDLAGRQDEEIK--ILSNLKENLESEVKLLHKEIQEHRVREEFLSSELQEKSNEFGLWDA 1272 Query: 218 EALSKVAKLKEAANKPIPLKNVYRK--NLVEKLKSAGIESKSSSADEISATTSWL 270 EA S L+ +A + + L+N ++ + E LK + +K++ ++I T +L Sbjct: 1273 EATSFYFDLQISAVREVLLENKVQELTGVCENLKDEAV-TKTTEINQIKETVGFL 1326 >At5g51270.1 68418.m06356 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 819 Score = 27.9 bits (59), Expect = 8.1 Identities = 26/120 (21%), Positives = 45/120 (37%), Gaps = 10/120 (8%) Query: 167 KLKKQILTELMNGCPRHAYDPKKQMEIYEEYKTYLSSYTPEEIEWY---GLTWYEALSKV 223 K++ L L+ CP H + ME + I W+ + W E S + Sbjct: 509 KIRHPHLVLLLGACPDHGALVYEYMENGSLEDRLFQVNDSQPIPWFVRLRIAW-EVASAL 567 Query: 224 AKLKEAANKPI------PLKNVYRKNLVEKLKSAGIESKSSSADEISATTSWLSKMNPFG 277 L ++ PI P + N V K+ G+ + +AD +S + + +P G Sbjct: 568 VFLHKSKPTPIIHRDLKPANILLNHNFVSKVGDVGLSTMIQAADPLSTKFTMYKQTSPVG 627 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/44 (31%), Positives = 21/44 (47%) Query: 149 DHYLLKTPACDLVSVLALKLKKQILTELMNGCPRHAYDPKKQME 192 DH+ + P DL+S++ L + T + G R AY P E Sbjct: 113 DHWTSRCPQKDLLSLMDEPLTAETSTSTITGTGRAAYVPPSMRE 156 >At2g34250.1 68415.m04190 protein transport protein sec61, putative similar to PfSec61 [Plasmodium falciparum] GI:3057044; contains Pfam profile PF00344: eubacterial secY protein Length = 475 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 52 FVPQEGKWKRDELTGETYPIQNIPIPLKFPAEINE 86 FV G+WK E +G++ P+ + + PA ++ Sbjct: 320 FVNLLGQWKESEYSGQSIPVSGLAYLITAPASFSD 354 >At1g58025.1 68414.m06576 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487; contains prenyl group binding site (CAAX box) Prosite:PS00294 Length = 769 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Query: 232 KPIPLKNVYRKNLVEKLKSAGIESKSSSADEISATTSWLSKMNPFGKKD 280 KP+ L NVYRK ++KS+ SSS E SAT + + G+KD Sbjct: 129 KPVFL-NVYRKTKGIRIKSSKAVDGSSSVTEKSATDTVKVQDVVVGQKD 176 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.316 0.133 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,854,428 Number of Sequences: 28952 Number of extensions: 287309 Number of successful extensions: 791 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 783 Number of HSP's gapped (non-prelim): 12 length of query: 282 length of database: 12,070,560 effective HSP length: 80 effective length of query: 202 effective length of database: 9,754,400 effective search space: 1970388800 effective search space used: 1970388800 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -