BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001251-TA|BGIBMGA001251-PA|IPR011028|Cyclin-like, IPR004367|Cyclin, C-terminal (174 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 3.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 3.2 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 4.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 4.2 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 3.2 Identities = 12/50 (24%), Positives = 21/50 (42%) Query: 117 TCLEQIEDMVQSLIVERDSCPPNGQAREAAGWTPPPAPPHDKAHSNAATP 166 T Q+ ++ + + P Q ++A +PPP + H ATP Sbjct: 247 TATVQLSTCTRTTLKNNRASPYPMQRPKSASLSPPPHVYNPPDHIQQATP 296 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 3.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Query: 150 PPPAPPHDKAHSNAATPT 167 PP +P DK+ N +P+ Sbjct: 681 PPESPTRDKSKQNEKSPS 698 Score = 20.2 bits (40), Expect = 9.8 Identities = 11/35 (31%), Positives = 14/35 (40%) Query: 138 PNGQAREAAGWTPPPAPPHDKAHSNAATPTDVRDV 172 P EAA TP P S + P + RD+ Sbjct: 45 PAPPEEEAASPTPGDVPTPSSPRSISEDPLNCRDL 79 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 4.2 Identities = 13/44 (29%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Query: 128 SLIVERDSCPPNGQAREAAGWTPP-----PAPPHDKAHSNAATP 166 +L + S P + G PP P PPH +H TP Sbjct: 209 ALPISTSSLPSDFYRFSPTGLIPPHPGLSPHPPHLSSHPAIVTP 252 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 4.2 Identities = 13/44 (29%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Query: 128 SLIVERDSCPPNGQAREAAGWTPP-----PAPPHDKAHSNAATP 166 +L + S P + G PP P PPH +H TP Sbjct: 101 ALPISTSSLPSDFYRFSPTGLIPPHPGLSPHPPHLSSHPAIVTP 144 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.132 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,399 Number of Sequences: 317 Number of extensions: 1457 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 174 length of database: 114,650 effective HSP length: 53 effective length of query: 121 effective length of database: 97,849 effective search space: 11839729 effective search space used: 11839729 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.4 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -