BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001249-TA|BGIBMGA001249-PA|IPR007590|Protein of unknown function DUF572 (320 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.0 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 23 3.0 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 23 3.0 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 23 3.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/14 (64%), Positives = 9/14 (64%) Query: 4 RKVLNKYYPPDFDP 17 RK L KY P D DP Sbjct: 1411 RKGLGKYLPEDIDP 1424 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/40 (25%), Positives = 22/40 (55%) Query: 168 DYEGMLRQYQPETVEERKAREEKEDNDFIKSVKFNNCSKK 207 ++ G ++ + + E+K EKE+ + +K K N+ K+ Sbjct: 42 NFWGKYQKAVEKLLTEQKELAEKEEAETLKRYKLNDLEKR 81 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/40 (25%), Positives = 22/40 (55%) Query: 168 DYEGMLRQYQPETVEERKAREEKEDNDFIKSVKFNNCSKK 207 ++ G ++ + + E+K EKE+ + +K K N+ K+ Sbjct: 202 NFWGKYQKAVEKLLTEQKELAEKEEAETLKRYKLNDLEKR 241 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/40 (25%), Positives = 22/40 (55%) Query: 168 DYEGMLRQYQPETVEERKAREEKEDNDFIKSVKFNNCSKK 207 ++ G ++ + + E+K EKE+ + +K K N+ K+ Sbjct: 202 NFWGKYQKAVEKLLTEQKELAEKEEAETLKRYKLNDLEKR 241 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.312 0.127 0.363 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,628 Number of Sequences: 317 Number of extensions: 2000 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 320 length of database: 114,650 effective HSP length: 57 effective length of query: 263 effective length of database: 96,581 effective search space: 25400803 effective search space used: 25400803 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -