SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001249-TA|BGIBMGA001249-PA|IPR007590|Protein of unknown
function DUF572
         (320 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY823259-1|AAX18444.1|  194|Anopheles gambiae pburs protein.           25   2.1  

>AY823259-1|AAX18444.1|  194|Anopheles gambiae pburs protein.
          Length = 194

 Score = 25.4 bits (53), Expect = 2.1
 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 15  FDPSKIPRMKLAKNRQYTVRLMAPFNMRCATCGEYI 50
           +DP  + RM   ++    +RL  P + +C  CGE +
Sbjct: 159 YDPDGV-RMTDHESATMEIRLKEPVDCKCFKCGEMV 193


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.312    0.127    0.363 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 250,150
Number of Sequences: 2123
Number of extensions: 8428
Number of successful extensions: 22
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 22
Number of HSP's gapped (non-prelim): 1
length of query: 320
length of database: 516,269
effective HSP length: 64
effective length of query: 256
effective length of database: 380,397
effective search space: 97381632
effective search space used: 97381632
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 48 (23.4 bits)

- SilkBase 1999-2023 -