BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001249-TA|BGIBMGA001249-PA|IPR007590|Protein of unknown
function DUF572
(320 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 25 2.1
>AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein.
Length = 194
Score = 25.4 bits (53), Expect = 2.1
Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 1/36 (2%)
Query: 15 FDPSKIPRMKLAKNRQYTVRLMAPFNMRCATCGEYI 50
+DP + RM ++ +RL P + +C CGE +
Sbjct: 159 YDPDGV-RMTDHESATMEIRLKEPVDCKCFKCGEMV 193
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.312 0.127 0.363
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 250,150
Number of Sequences: 2123
Number of extensions: 8428
Number of successful extensions: 22
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 22
Number of HSP's gapped (non-prelim): 1
length of query: 320
length of database: 516,269
effective HSP length: 64
effective length of query: 256
effective length of database: 380,397
effective search space: 97381632
effective search space used: 97381632
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 48 (23.4 bits)
- SilkBase 1999-2023 -