GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001249-TA|BGIBMGA001249-PA|IPR007590|Protein of unknown
function DUF572
         (320 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    23   2.7  

>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 23.4 bits (48), Expect = 2.7
 Identities = 15/50 (30%), Positives = 21/50 (42%)

Query: 249 WNRSVGGLITKPALANLVRSKKPESAETSKFTTEALSKSNNAAESNTKST 298
           W    GG   KP     V  ++       KF  EA S S  A  +++KS+
Sbjct: 240 WYLPSGGCHCKPGYQADVEKQECTECPIGKFKHEAGSHSCEACPAHSKSS 289


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.312    0.127    0.363 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,920
Number of Sequences: 429
Number of extensions: 2916
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 7
Number of HSP's gapped (non-prelim): 1
length of query: 320
length of database: 140,377
effective HSP length: 58
effective length of query: 262
effective length of database: 115,495
effective search space: 30259690
effective search space used: 30259690
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 44 (21.8 bits)