BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001246-TA|BGIBMGA001246-PA|IPR002223|Proteinase
inhibitor I2, Kunitz metazoa
(246 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 23 1.6
>DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory
protein 1 protein.
Length = 112
Score = 23.4 bits (48), Expect = 1.6
Identities = 12/34 (35%), Positives = 17/34 (50%)
Query: 140 TRIKKMKATPSSDDNEVMLNDKPTVRDSMKCATG 173
T +K S + E LND+ + +KCATG
Sbjct: 21 TCVKPQLTRISDEAIESTLNDRRYLLRQLKCATG 54
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.318 0.132 0.417
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 60,720
Number of Sequences: 317
Number of extensions: 2567
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 246
length of database: 114,650
effective HSP length: 55
effective length of query: 191
effective length of database: 97,215
effective search space: 18568065
effective search space used: 18568065
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 42 (21.0 bits)
- SilkBase 1999-2023 -