SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001246-TA|BGIBMGA001246-PA|IPR002223|Proteinase
inhibitor I2, Kunitz metazoa
         (246 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ855488-1|ABH88175.1|  112|Tribolium castaneum chemosensory pro...    23   1.6  

>DQ855488-1|ABH88175.1|  112|Tribolium castaneum chemosensory
           protein 1 protein.
          Length = 112

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 12/34 (35%), Positives = 17/34 (50%)

Query: 140 TRIKKMKATPSSDDNEVMLNDKPTVRDSMKCATG 173
           T +K      S +  E  LND+  +   +KCATG
Sbjct: 21  TCVKPQLTRISDEAIESTLNDRRYLLRQLKCATG 54


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.318    0.132    0.417 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 60,720
Number of Sequences: 317
Number of extensions: 2567
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 246
length of database: 114,650
effective HSP length: 55
effective length of query: 191
effective length of database: 97,215
effective search space: 18568065
effective search space used: 18568065
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 42 (21.0 bits)

- SilkBase 1999-2023 -