BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001246-TA|BGIBMGA001246-PA|IPR002223|Proteinase inhibitor I2, Kunitz metazoa (246 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 3.4 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 22 4.5 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 6.0 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 7.9 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/43 (20%), Positives = 19/43 (44%) Query: 7 VLGAVRARPPTAHAREVATENVTSEDPEIENLVEEHLERCQFT 49 +L A++ + + + E + +V+ HL+ C FT Sbjct: 151 ILAAMQQSSHSRSQEKAVAAELEDEQRLLATVVQAHLDTCDFT 193 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/29 (34%), Positives = 16/29 (55%) Query: 135 ESVSETRIKKMKATPSSDDNEVMLNDKPT 163 ESVS ++TP S +++D+PT Sbjct: 252 ESVSSETNHNERSTPRSHAKPSLIDDEPT 280 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 6.0 Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 178 WSNCVGDCNYAVRLNYRLVLSKDSGLGTSCRRLVKSRSCRPVQCRNAILAPTTDS 232 W C G +Y V SG+G + L + V + +IL P++DS Sbjct: 200 WKQCEGKIDYLVA--GAGTGGTISGIGRKLKELSPNIKIIAVDPKGSILDPSSDS 252 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 7.9 Identities = 6/14 (42%), Positives = 9/14 (64%) Query: 73 ICKLPMSVGHCRRY 86 +C LP VG ++Y Sbjct: 586 VCSLPCEVGQAKKY 599 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.132 0.417 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,480 Number of Sequences: 429 Number of extensions: 3657 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 4 length of query: 246 length of database: 140,377 effective HSP length: 56 effective length of query: 190 effective length of database: 116,353 effective search space: 22107070 effective search space used: 22107070 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -