BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001245-TA|BGIBMGA001245-PA|IPR000884|Thrombospondin, type I, IPR002861|Reeler region, IPR009465|Spondin, N-terminal (541 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase Wis1|Schizosaccha... 29 2.2 SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces ... 27 8.8 >SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase Wis1|Schizosaccharomyces pombe|chr 2|||Manual Length = 605 Score = 28.7 bits (61), Expect = 2.2 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Query: 285 SPDWIVGVSALELCNVNCTWRTSASLSLYPYDAGTDNG--ISYTSRRMPTIPAAPVRALR 342 +P ++ +S+ N + + + SLSL +G+DN +S SR +P+ P P RA+ Sbjct: 29 TPGSLLSLSSSSSSNTDSSGSSLGSLSLNSNSSGSDNDSKVSSPSREIPSDPPLP-RAVP 87 Query: 343 T 343 T Sbjct: 88 T 88 >SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2111 Score = 26.6 bits (56), Expect = 8.8 Identities = 8/15 (53%), Positives = 14/15 (93%) Query: 145 GPSSLNRQPPIVEPC 159 GP++L+R+P I++PC Sbjct: 186 GPAALSREPTILQPC 200 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.319 0.132 0.434 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,512,708 Number of Sequences: 5004 Number of extensions: 101181 Number of successful extensions: 217 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 216 Number of HSP's gapped (non-prelim): 2 length of query: 541 length of database: 2,362,478 effective HSP length: 76 effective length of query: 465 effective length of database: 1,982,174 effective search space: 921710910 effective search space used: 921710910 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -