BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001245-TA|BGIBMGA001245-PA|IPR000884|Thrombospondin, type I, IPR002861|Reeler region, IPR009465|Spondin, N-terminal (541 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 26 0.91 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 26 0.91 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 25.8 bits (54), Expect = 0.91 Identities = 11/30 (36%), Positives = 18/30 (60%) Query: 206 RVWQEGRVATTGLRRLADDGSTTALEKELK 235 R+ Q GR+ T ++ + D+G T +ELK Sbjct: 32 RILQNGRILTNYIKCMLDEGPCTNEGRELK 61 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 25.8 bits (54), Expect = 0.91 Identities = 11/30 (36%), Positives = 18/30 (60%) Query: 206 RVWQEGRVATTGLRRLADDGSTTALEKELK 235 R+ Q GR+ T ++ + D+G T +ELK Sbjct: 32 RILQNGRILTNYIKCMLDEGPCTNEGRELK 61 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.132 0.434 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,569 Number of Sequences: 429 Number of extensions: 6734 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 2 length of query: 541 length of database: 140,377 effective HSP length: 61 effective length of query: 480 effective length of database: 114,208 effective search space: 54819840 effective search space used: 54819840 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -