BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001243-TA|BGIBMGA001243-PA|IPR005326|Plectin/S10, N-terminal (176 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 21 5.7 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 21 5.7 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 21 5.7 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 21.0 bits (42), Expect = 5.7 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 12 YEYLFKEGVMVAKKDY-HAPKHTELEKIPNLQV 43 Y+ L + + +DY + TELEK PN+++ Sbjct: 97 YDALTGQCIYSISRDYLNNVLLTELEKYPNVKI 129 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 5.7 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 12 YEYLFKEGVMVAKKDY-HAPKHTELEKIPNLQV 43 Y+ L + + +DY + TELEK PN+++ Sbjct: 97 YDALTGQCIYSISRDYLNNVLLTELEKYPNVKI 129 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 5.7 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 12 YEYLFKEGVMVAKKDY-HAPKHTELEKIPNLQV 43 Y+ L + + +DY + TELEK PN+++ Sbjct: 97 YDALTGQCIYSISRDYLNNVLLTELEKYPNVKI 129 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.136 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,665 Number of Sequences: 317 Number of extensions: 1746 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 176 length of database: 114,650 effective HSP length: 53 effective length of query: 123 effective length of database: 97,849 effective search space: 12035427 effective search space used: 12035427 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.4 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -