BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001241-TA|BGIBMGA001241-PA|IPR001404|Heat shock protein Hsp90, IPR003594|ATP-binding region, ATPase-like, IPR009079|Four-helical cytokine (658 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 23 7.9 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 23 7.9 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.0 bits (47), Expect = 7.9 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 235 SNFVSSP--IFLNNDQVNSIKPLWLFEPKEITQEQHIEFYKFISNSY 279 + F++ P + L ++ + I P +L I +E+H+E + I N Y Sbjct: 348 AEFIAKPEALKLLDENWDLIAPYFLDYNYTIPKEKHVEVARLIRNYY 394 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.0 bits (47), Expect = 7.9 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 235 SNFVSSP--IFLNNDQVNSIKPLWLFEPKEITQEQHIEFYKFISNSY 279 + F++ P + L ++ + I P +L I +E+H+E + I N Y Sbjct: 348 AEFIAKPEALKLLDENWDLIAPYFLDYNYTIPKEKHVEVARLIRNYY 394 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.133 0.364 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,764 Number of Sequences: 429 Number of extensions: 7048 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 2 length of query: 658 length of database: 140,377 effective HSP length: 62 effective length of query: 596 effective length of database: 113,779 effective search space: 67812284 effective search space used: 67812284 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -