BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001241-TA|BGIBMGA001241-PA|IPR001404|Heat shock protein Hsp90, IPR003594|ATP-binding region, ATPase-like, IPR009079|Four-helical cytokine (658 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 pro... 23 5.0 AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 prot... 23 5.0 >AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 protein. Length = 384 Score = 23.4 bits (48), Expect = 5.0 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 3/65 (4%) Query: 479 IEVLFCYEM--YDELV-LLELKEFGGRALVSVENDMQRDPLDKSESIIGSEGLQQSQVDE 535 + VL +EM +EL L+ LKE + + + K + + GL+Q+ V Sbjct: 67 VSVLDDWEMTGLEELAHLMSLKEKNPNVKILLSMGGWNEGSQKYSQVAANPGLRQAMVTS 126 Query: 536 LISFL 540 ++SF+ Sbjct: 127 VLSFI 131 >AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 protein. Length = 384 Score = 23.4 bits (48), Expect = 5.0 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 3/65 (4%) Query: 479 IEVLFCYEM--YDELV-LLELKEFGGRALVSVENDMQRDPLDKSESIIGSEGLQQSQVDE 535 + VL +EM +EL L+ LKE + + + K + + GL+Q+ V Sbjct: 67 VSVLDDWEMTGLEELAHLMSLKEKNPNVKILLSMGGWNEGSQKYSQVAANPGLRQAMVTS 126 Query: 536 LISFL 540 ++SF+ Sbjct: 127 VLSFI 131 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.133 0.364 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,769 Number of Sequences: 317 Number of extensions: 5581 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 17 Number of HSP's gapped (non-prelim): 2 length of query: 658 length of database: 114,650 effective HSP length: 61 effective length of query: 597 effective length of database: 95,313 effective search space: 56901861 effective search space used: 56901861 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -