BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001239-TA|BGIBMGA001239-PA|IPR008728|PAXNEB
(284 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 28 0.091
>AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate
neuroblasts defectiveprotein protein.
Length = 224
Score = 27.9 bits (59), Expect = 0.091
Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
Query: 1 MSLTSELPQPCALPPEDEKAPSTDAEKMKI--AWRYEGLSQVESSFGSN 47
+S++ P + PPE+ PS DA +I A+ L ++E F SN
Sbjct: 91 VSVSPTTPPTPSPPPEERLTPSKDASSKRIXTAFTSTQLLELEREFASN 139
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.319 0.134 0.397
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 68,625
Number of Sequences: 317
Number of extensions: 2791
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 284
length of database: 114,650
effective HSP length: 56
effective length of query: 228
effective length of database: 96,898
effective search space: 22092744
effective search space used: 22092744
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 43 (21.4 bits)
- SilkBase 1999-2023 -