GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001239-TA|BGIBMGA001239-PA|IPR008728|PAXNEB
         (284 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY695257-1|AAW21974.1|  224|Tribolium castaneum intermediate neu...    28   0.091

>AY695257-1|AAW21974.1|  224|Tribolium castaneum intermediate
           neuroblasts defectiveprotein protein.
          Length = 224

 Score = 27.9 bits (59), Expect = 0.091
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 1   MSLTSELPQPCALPPEDEKAPSTDAEKMKI--AWRYEGLSQVESSFGSN 47
           +S++   P   + PPE+   PS DA   +I  A+    L ++E  F SN
Sbjct: 91  VSVSPTTPPTPSPPPEERLTPSKDASSKRIXTAFTSTQLLELEREFASN 139


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.319    0.134    0.397 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 68,625
Number of Sequences: 317
Number of extensions: 2791
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 284
length of database: 114,650
effective HSP length: 56
effective length of query: 228
effective length of database: 96,898
effective search space: 22092744
effective search space used: 22092744
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 43 (21.4 bits)