BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001239-TA|BGIBMGA001239-PA|IPR008728|PAXNEB (284 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.76 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.76 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 23 3.1 AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding prote... 21 9.4 AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-bind... 21 9.4 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 25.0 bits (52), Expect = 0.76 Identities = 7/31 (22%), Positives = 19/31 (61%) Query: 3 LTSELPQPCALPPEDEKAPSTDAEKMKIAWR 33 LT + ++PPED + + ++ ++++W+ Sbjct: 1103 LTQTMEDVPSIPPEDVRCAALTSQSLQVSWQ 1133 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 25.0 bits (52), Expect = 0.76 Identities = 7/31 (22%), Positives = 19/31 (61%) Query: 3 LTSELPQPCALPPEDEKAPSTDAEKMKIAWR 33 LT + ++PPED + + ++ ++++W+ Sbjct: 1099 LTQTMEDVPSIPPEDVRCAALTSQSLQVSWQ 1129 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 203 TNPVYKDYHGLFHITKLTALYTLV 226 TN +Y Y+G H + YT+V Sbjct: 359 TNYLYLTYNGTVHDVEFPGXYTMV 382 >AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding protein ASP2 protein. Length = 142 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Query: 192 RIESFAGSEKETNPVYK 208 RIE G+E PVYK Sbjct: 76 RIEMLKGTELYVEPVYK 92 >AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-binding protein ASP2 protein. Length = 142 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Query: 192 RIESFAGSEKETNPVYK 208 RIE G+E PVYK Sbjct: 76 RIEMLKGTELYVEPVYK 92 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.134 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,360 Number of Sequences: 429 Number of extensions: 3647 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 5 length of query: 284 length of database: 140,377 effective HSP length: 57 effective length of query: 227 effective length of database: 115,924 effective search space: 26314748 effective search space used: 26314748 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -