BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001237-TA|BGIBMGA001237-PA|IPR001544|Aminotransferase, class IV, IPR005786|Branched-chain amino acid aminotransferase II (426 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 26 0.58 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 5.4 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 5.4 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 5.4 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 5.4 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 5.4 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 5.4 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 5.4 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 5.4 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 7.2 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 22 7.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 9.5 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 9.5 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 9.5 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 25.8 bits (54), Expect = 0.58 Identities = 11/28 (39%), Positives = 15/28 (53%) Query: 39 VQADHVAPSPTQKPHPQITPEISFKYED 66 +Q +AP+ Q P+ Q P S KY D Sbjct: 76 LQPQRLAPTHLQSPNTQTHPSASCKYAD 103 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 5.4 Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 39 VQADHVAPSPTQKPHPQITPEISFKYED 66 +Q +A + Q P+ Q P S KY D Sbjct: 76 LQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 5.4 Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 39 VQADHVAPSPTQKPHPQITPEISFKYED 66 +Q +A + Q P+ Q P S KY D Sbjct: 76 LQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 5.4 Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 39 VQADHVAPSPTQKPHPQITPEISFKYED 66 +Q +A + Q P+ Q P S KY D Sbjct: 76 LQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 5.4 Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 39 VQADHVAPSPTQKPHPQITPEISFKYED 66 +Q +A + Q P+ Q P S KY D Sbjct: 76 LQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 5.4 Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 39 VQADHVAPSPTQKPHPQITPEISFKYED 66 +Q +A + Q P+ Q P S KY D Sbjct: 76 LQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 5.4 Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 39 VQADHVAPSPTQKPHPQITPEISFKYED 66 +Q +A + Q P+ Q P S KY D Sbjct: 32 LQPQRLASTHLQSPNTQTHPSASCKYAD 59 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 5.4 Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 39 VQADHVAPSPTQKPHPQITPEISFKYED 66 +Q +A + Q P+ Q P S KY D Sbjct: 76 LQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 5.4 Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 39 VQADHVAPSPTQKPHPQITPEISFKYED 66 +Q +A + Q P+ Q P S KY D Sbjct: 76 LQPQRLASTHLQSPNTQTHPSASCKYAD 103 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.2 bits (45), Expect = 7.2 Identities = 7/20 (35%), Positives = 12/20 (60%) Query: 38 SVQADHVAPSPTQKPHPQIT 57 ++++D + P P P PQ T Sbjct: 385 ALKSDEIPPEPVPTPEPQPT 404 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 22.2 bits (45), Expect = 7.2 Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 304 FMVHINDQGDKQLSTPPLNG 323 FM HI++ GD + T +NG Sbjct: 231 FMSHIHNDGDNKPDTILVNG 250 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 9.5 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Query: 105 LGGWQKPEIMPFENLNIHPAAKA--LHYAIQLFE 136 LGGW + + L +PAA+A + + +Q E Sbjct: 1475 LGGWNDSQGDKYSRLVNNPAARARFIKHVLQFLE 1508 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 9.5 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 95 HMLKIYYHKELGGWQKPEIMP 115 H I+Y E G W+ +I P Sbjct: 1427 HGYTIHYKPEFGDWETVQIGP 1447 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.8 bits (44), Expect = 9.5 Identities = 15/64 (23%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Query: 355 RVIQ--LNQQGRLLEMFGAGTAVIISPISRVGFLEQNIEIPTMKQSNPVFQRVKDTLLAI 412 R++Q ++Q R + AG + SP +G++ ++ +P F A Sbjct: 391 RIVQPMIDQSNRAVFSPHAGPSGAYSPDGTMGYMMDGQQMMHRPPGDPAFHNQYAHYPAE 450 Query: 413 QYGH 416 YGH Sbjct: 451 YYGH 454 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,879 Number of Sequences: 317 Number of extensions: 4534 Number of successful extensions: 19 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 15 length of query: 426 length of database: 114,650 effective HSP length: 59 effective length of query: 367 effective length of database: 95,947 effective search space: 35212549 effective search space used: 35212549 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -