BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001236-TA|BGIBMGA001236-PA|IPR005631|Protein of unknown function DUF339 (114 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g51040.1 68418.m06327 expressed protein 46 5e-06 At1g60300.1 68414.m06790 apical meristem formation protein-relat... 29 0.99 At3g48190.1 68416.m05257 ataxia-telangiectasia mutated protein (... 28 1.3 At2g22410.1 68415.m02657 pentatricopeptide (PPR) repeat-containi... 28 1.7 At5g01120.1 68418.m00016 hypothetical protein contains Pfam prof... 27 2.3 At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR ... 27 3.0 At4g24190.2 68417.m03473 shepherd protein (SHD) / clavata format... 27 4.0 At4g24190.1 68417.m03472 shepherd protein (SHD) / clavata format... 27 4.0 At5g20830.1 68418.m02474 sucrose synthase / sucrose-UDP glucosyl... 26 5.3 At3g02570.1 68416.m00248 phosphomannose isomerase type I family ... 26 5.3 At2g44150.1 68415.m05492 SET domain-containing protein (ASHH3) l... 26 5.3 At2g26910.1 68415.m03228 ABC transporter family protein similar ... 26 5.3 At3g43190.1 68416.m04558 sucrose synthase, putative / sucrose-UD... 26 7.0 At1g54430.1 68414.m06209 hypothetical protein 26 7.0 At5g40200.1 68418.m04878 DegP protease, putative contains simila... 25 9.2 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 25 9.2 At3g30420.1 68416.m03847 hypothetical protein low similarity to ... 25 9.2 At2g19010.1 68415.m02219 GDSL-motif lipase/hydrolase family prot... 25 9.2 At1g10330.1 68414.m01163 pentatricopeptide (PPR) repeat-containi... 25 9.2 >At5g51040.1 68418.m06327 expressed protein Length = 188 Score = 46.4 bits (105), Expect = 5e-06 Identities = 30/112 (26%), Positives = 56/112 (50%), Gaps = 13/112 (11%) Query: 11 YDVEKQQPLEKRKA--RLHYQSRKRGMLENDLLLSTFAKKYLNGFNEKQTMMYDRLINSP 68 +D++ KR+ RL Y+S++RG LE DL+L + ++ +N +E ++N Sbjct: 59 FDIDLSNEENKRRTINRLLYRSKQRGFLELDLVLGNWVEENVNSMDENGVKSLIHVLNLE 118 Query: 69 SNDWDIFYWIVEKKPTPKEFDN---------EIMNLLKKHAKNEDKIALRQP 111 + D++ W+ E++ P+ + ++M L KHA E + A QP Sbjct: 119 NP--DLWKWLTEQEQPPEAVSSNPVFSALHEKVMKNLNKHAAPETRAAAGQP 168 >At1g60300.1 68414.m06790 apical meristem formation protein-related contains similarity to CUC1 [Arabidopsis thaliana] gi|12060422|dbj|BAB20598 and NAM [Petunia x hybrida] gi|1279640|emb|CAA63101 Length = 322 Score = 28.7 bits (61), Expect = 0.99 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Query: 27 HYQSRKRGMLENDLLLSTFAKKYLNGFNEKQTMMYDRLINSPSNDW 72 H+ + +LEN+LL S YL+ E+ D ++ S N+W Sbjct: 161 HFYTTSESVLENELLPSY--GYYLSNTQEEDEFYLDAIMTSEGNEW 204 >At3g48190.1 68416.m05257 ataxia-telangiectasia mutated protein (Atm) identical to ataxia-telangiectasia mutated protein (Atm) [Arabidopsis thaliana] GI:7529272; contains Pfam profile PF00855: PWWP domain; contains GA donor splice site at exon 73 Length = 3255 Score = 28.3 bits (60), Expect = 1.3 Identities = 10/26 (38%), Positives = 17/26 (65%) Query: 72 WDIFYWIVEKKPTPKEFDNEIMNLLK 97 WD+ Y ++EK+ PK +N + +L K Sbjct: 1701 WDVLYNLLEKESDPKVLENILYHLCK 1726 >At2g22410.1 68415.m02657 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 681 Score = 27.9 bits (59), Expect = 1.7 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Query: 19 LEKRKARLHYQSRKRGMLENDLLLSTFAKKYLNGF---NEKQTMMYDRLINSPSNDWDIF 75 LEK K LH + + M+ N L+L FA L F +E + + Y I + +IF Sbjct: 60 LEKCKLLLHLKQIQAQMIINGLILDPFASSRLIAFCALSESRYLDYSVKILKGIENPNIF 119 Query: 76 YWIV 79 W V Sbjct: 120 SWNV 123 >At5g01120.1 68418.m00016 hypothetical protein contains Pfam profile PF05056: Protein of unknown function (DUF674) Length = 510 Score = 27.5 bits (58), Expect = 2.3 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 51 NGFNEKQT--MMYDRLINSPSNDWDIFYWIVEKKPTPKEFDNEIMNLLKKHA 100 +GF ++ T M+ D LI +PSN ++ EK+ E + ++N+ K+ A Sbjct: 416 SGFVKRGTKFMVTDDLIINPSNSTSTIGFLKEKQTRLDEVEIRVINMTKEEA 467 >At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 874 Score = 27.1 bits (57), Expect = 3.0 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 69 SNDWDIFYW-IVEKKPTPKEFDNEI 92 SND+DI W +V K PT K +I Sbjct: 203 SNDFDIAIWVVVSKNPTVKRIQEDI 227 >At4g24190.2 68417.m03473 shepherd protein (SHD) / clavata formation protein, putative nearly identical to SHEPHERD [Arabidopsis thaliana] GI:19570872; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 823 Score = 26.6 bits (56), Expect = 4.0 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query: 13 VEKQQPLEKRKARLHYQSRKRGMLENDLL--LSTFAKKYLNGFNEK 56 +E Q L+K K L + R GM + DL+ L T AK + F EK Sbjct: 137 LEIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEK 182 >At4g24190.1 68417.m03472 shepherd protein (SHD) / clavata formation protein, putative nearly identical to SHEPHERD [Arabidopsis thaliana] GI:19570872; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 823 Score = 26.6 bits (56), Expect = 4.0 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query: 13 VEKQQPLEKRKARLHYQSRKRGMLENDLL--LSTFAKKYLNGFNEK 56 +E Q L+K K L + R GM + DL+ L T AK + F EK Sbjct: 137 LEIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEK 182 >At5g20830.1 68418.m02474 sucrose synthase / sucrose-UDP glucosyltransferase (SUS1) identical to SP|P49040 Sucrose synthase (EC 2.4.1.13) (Sucrose-UDP glucosyltransferase) {Arabidopsis thaliana} Length = 808 Score = 26.2 bits (55), Expect = 5.3 Identities = 13/44 (29%), Positives = 23/44 (52%) Query: 65 INSPSNDWDIFYWIVEKKPTPKEFDNEIMNLLKKHAKNEDKIAL 108 I SP D I++ E+K +F +EI LL +N++ + + Sbjct: 523 IVSPGADMSIYFPYTEEKRRLTKFHSEIEELLYSDVENKEHLCV 566 >At3g02570.1 68416.m00248 phosphomannose isomerase type I family protein contains Pfam profile: PF01238 phosphomannose isomerase type I Length = 432 Score = 26.2 bits (55), Expect = 5.3 Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 19 LEKRKARLHYQSRKRGMLENDLLLSTFAKKYLN 51 + K K RLH +S++R + + + L+ K+Y N Sbjct: 227 VSKLKRRLHMESQERQLTDKERLVLKLEKQYPN 259 >At2g44150.1 68415.m05492 SET domain-containing protein (ASHH3) low similarity to huntingtin interacting protein 1 [Homo sapiens] GI:12697196; contains Pfam profile PF00856: SET domain; identical to cDNA ASH1-like protein 3 (ASHH3) partial cds GI:15488419 Length = 363 Score = 26.2 bits (55), Expect = 5.3 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Query: 60 MYDRLINS--PSNDWDIFYWIVEKKPTPKEFDNEIMNLLKK 98 ++D+L+N S ++++ W+ + KPTP F + L KK Sbjct: 16 VFDKLLNQIGESEEFELPEWLNKGKPTPYIFIRRNIYLTKK 56 >At2g26910.1 68415.m03228 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1420 Score = 26.2 bits (55), Expect = 5.3 Identities = 11/27 (40%), Positives = 18/27 (66%) Query: 56 KQTMMYDRLINSPSNDWDIFYWIVEKK 82 +Q ++ DRL+NS ND + F+ V K+ Sbjct: 63 EQRLLLDRLVNSVENDPEQFFARVRKR 89 >At3g43190.1 68416.m04558 sucrose synthase, putative / sucrose-UDP glucosyltransferase, putative strong similarity to SP|P49040 Sucrose synthase (EC 2.4.1.13) (Sucrose-UDP glucosyltransferase) {Arabidopsis thaliana} (SUS1) Length = 808 Score = 25.8 bits (54), Expect = 7.0 Identities = 14/44 (31%), Positives = 21/44 (47%) Query: 65 INSPSNDWDIFYWIVEKKPTPKEFDNEIMNLLKKHAKNEDKIAL 108 I SP D I++ E+K F EI LL +NE+ + + Sbjct: 523 IVSPGADMSIYFAYTEEKRRLTAFHLEIEELLYSDVENEEHLCV 566 >At1g54430.1 68414.m06209 hypothetical protein Length = 1639 Score = 25.8 bits (54), Expect = 7.0 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 51 NGFNEKQTMMYDRLINSPSNDWDIFYWIVEKKPTPKEF-DNEIMNLLKKHAKNEDKIA 107 N NE+Q ++YD ++ S N +++ T K F I++ L+ + KN +A Sbjct: 1149 NKLNEQQRIIYDDVLKSVINKEGKLFFLYGAGGTGKTFLYKTIISALRSNGKNVMPVA 1206 >At5g40200.1 68418.m04878 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 592 Score = 25.4 bits (53), Expect = 9.2 Identities = 9/25 (36%), Positives = 16/25 (64%) Query: 20 EKRKARLHYQSRKRGMLENDLLLST 44 E+ ++RLH+ K G N +++ST Sbjct: 80 ERSRSRLHHSDTKNGDCSNGMIVST 104 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 25.4 bits (53), Expect = 9.2 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Query: 67 SPSND--WDIFYWIVEKKPTPKEFDNEIMN 94 SP+N WD F+ +VE P P D E+ N Sbjct: 191 SPANSMAWDYFF-MVENMPGPNLDDREVRN 219 >At3g30420.1 68416.m03847 hypothetical protein low similarity to SP|Q9UUA2 DNA repair and recombination protein pif1, mitochondrial precursor {Schizosaccharomyces pombe} Length = 837 Score = 25.4 bits (53), Expect = 9.2 Identities = 15/55 (27%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query: 54 NEKQTMMYDRLINSPSNDWDIFYWIVEKKPTPKEF-DNEIMNLLKKHAKNEDKIA 107 NE+Q ++YD ++ S +N +++ T K F I++ L+ + KN +A Sbjct: 350 NEQQRIIYDDVLKSVTNKEGKLFFLYGDGGTGKTFLYKTIISALRSNGKNVMPVA 404 >At2g19010.1 68415.m02219 GDSL-motif lipase/hydrolase family protein similar to family II lipase EXL1 GI:15054382 from [Arabidopsis thaliana]; contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase Length = 344 Score = 25.4 bits (53), Expect = 9.2 Identities = 13/52 (25%), Positives = 29/52 (55%), Gaps = 5/52 (9%) Query: 64 LINSPSNDWDIFYWI-----VEKKPTPKEFDNEIMNLLKKHAKNEDKIALRQ 110 +IN SND+ Y++ +++ TPK++ ++ + + H KN ++ R+ Sbjct: 151 MINIGSNDYINNYFMSKPYNTKRRYTPKQYAYSLIIIYRSHLKNLHRLGARK 202 >At1g10330.1 68414.m01163 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 467 Score = 25.4 bits (53), Expect = 9.2 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query: 26 LHYQSRKRGMLENDLLLSTFAKKYLN-GFNEKQTMMYDRLIN 66 LH Q+ KRG L + + ++F + Y G E M+D ++N Sbjct: 108 LHGQALKRGFLWDPFVQTSFVRFYGEVGDLESSRKMFDDILN 149 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,019,169 Number of Sequences: 28952 Number of extensions: 126213 Number of successful extensions: 350 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 10 Number of HSP's that attempted gapping in prelim test: 341 Number of HSP's gapped (non-prelim): 19 length of query: 114 length of database: 12,070,560 effective HSP length: 72 effective length of query: 42 effective length of database: 9,986,016 effective search space: 419412672 effective search space used: 419412672 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -