BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001231-TA|BGIBMGA001231-PA|IPR004827|Basic-leucine zipper (bZIP) transcription factor, IPR004878|Protein of unknown function DUF270 (533 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.25 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 27 0.33 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 26 0.75 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 4.0 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 22 9.3 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 27.5 bits (58), Expect = 0.25 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Query: 195 WLNVVVQDTRDDIVDVAYDQPILFRYANISGHKQIDINDKLDNLT--IEEIVDYPKPLLS 252 WL +VD YD P L +Y + D + + D +T + + +P+ + Sbjct: 1981 WLLSAAVSPSRRVVDAGYDVPTLSKYLDWIAVMCYDYHGQWDKITGHVAPMYAHPEDADA 2040 Query: 253 VFNNNRT 259 FN N T Sbjct: 2041 TFNTNFT 2047 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 27.1 bits (57), Expect = 0.33 Identities = 14/48 (29%), Positives = 22/48 (45%) Query: 208 VDVAYDQPILFRYANISGHKQIDINDKLDNLTIEEIVDYPKPLLSVFN 255 VD++YD P L +Y +I D+ D +T YP + + N Sbjct: 186 VDISYDVPALSKYLDIINVMAYDLRGSWDGVTGHHSGLYPSAVDTTTN 233 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 25.8 bits (54), Expect = 0.75 Identities = 13/43 (30%), Positives = 22/43 (51%) Query: 204 RDDIVDVAYDQPILFRYANISGHKQIDINDKLDNLTIEEIVDY 246 R +V D P + A S Q+++N++ +NLT + V Y Sbjct: 210 RKQLVSEHPDSPNSKKSATPSPPPQLEVNERKENLTCQPAVPY 252 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.4 bits (48), Expect = 4.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Query: 235 LDNLTIEEIVDYPKPLLSVFNNN 257 L L I+E VDY KPL+ N Sbjct: 765 LKRLGIDESVDYTKPLVDAQTMN 787 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 22.2 bits (45), Expect = 9.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 323 KQHVELALLQINIWETILFVLM 344 K H L L + +W T+ F+L+ Sbjct: 245 KDHNSLYSLHLLLWITVTFILL 266 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.325 0.138 0.418 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,411 Number of Sequences: 317 Number of extensions: 5689 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 6 length of query: 533 length of database: 114,650 effective HSP length: 60 effective length of query: 473 effective length of database: 95,630 effective search space: 45232990 effective search space used: 45232990 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -