BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001230-TA|BGIBMGA001230-PA|IPR004878|Protein of unknown function DUF270 (503 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 4.7 DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 24 8.3 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.0 bits (52), Expect = 4.7 Identities = 14/55 (25%), Positives = 23/55 (41%) Query: 283 KDIELGSHKMIQRFGFMHMLATNLCEWLYVLVEETKHEIHHLEHAMLSPENTTHN 337 KDIE + + LCE + L +E + H L+H + S + + N Sbjct: 3230 KDIEEDFNVFLSTVNHSRTFYYQLCERIAALSDELEESRHILQHKLYSNNSQSLN 3284 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 24.2 bits (50), Expect = 8.3 Identities = 13/37 (35%), Positives = 17/37 (45%) Query: 307 CEWLYVLVEETKHEIHHLEHAMLSPENTTHNVTEEIS 343 C + E+T E H E +PE +T TEE S Sbjct: 15 CIVVIASAEKTDQEAEHGETVPATPEPSTTEATEEES 51 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.322 0.134 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 423,860 Number of Sequences: 2123 Number of extensions: 14855 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 23 Number of HSP's gapped (non-prelim): 2 length of query: 503 length of database: 516,269 effective HSP length: 67 effective length of query: 436 effective length of database: 374,028 effective search space: 163076208 effective search space used: 163076208 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -